Basic Information

Gene Symbol
-
Assembly
GCA_951799465.1
Location
OX637270.1:202807-203344[-]

Transcription Factor Domain

TF Family
HMGA
Domain
HMGA domain
PFAM
AnimalTFDB
TF Group
Unclassified Structure
Description
This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 4 0.0026 49 3.8 2.0 11 16 13 18 11 20 0.83
2 4 0.16 3e+03 -1.9 3.7 12 15 33 36 31 50 0.71
3 4 5.9e-10 1.1e-05 25.0 2.7 4 21 54 71 52 72 0.87
4 4 0.12 2.3e+03 -1.6 4.6 10 15 84 89 83 90 0.84

Sequence Information

Coding Sequence
atgtctgatGATGGATCAACTGCAGTTGAGAAGAAAGGGAGAGGCCGGCCTAAATCTAATGGAACACAAgctgATTCAAAAGGAGATTCAAAGAAAAGGGGAAGACCAGCAGCAGCTCCAGCAAAAGTCAAAGAATCTAAAAATTCTTCTGATGAAGAACAGGCACCAGTAGCCAAAAGAGGTCGAGGAAGACCTAAAGGATCAAAAAAGAAGGCAGCACCTAAAGCCAAgTCTACATCAGGAGAAGGTAGAGCGAGAGGGCGACCTCGTAAAGATGCAGCTCCTCCTAAGAAAGACACTGCATCTTCTGAAGAGGAGCAGGATGATGAAGAAGAAGATGAAGGCTCTGACGAGTAG
Protein Sequence
MSDDGSTAVEKKGRGRPKSNGTQADSKGDSKKRGRPAAAPAKVKESKNSSDEEQAPVAKRGRGRPKGSKKKAAPKAKSTSGEGRARGRPRKDAAPPKKDTASSEEEQDDEEEDEGSDE

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00985119; iTF_00782657; iTF_01079073; iTF_01143841; iTF_01507233; iTF_00621250; iTF_00695618; iTF_01147394; iTF_00248099; iTF_00421379; iTF_00775267; iTF_00212484; iTF_00986116; iTF_01143108; iTF_01140934; iTF_01142406; iTF_01144550; iTF_00778023; iTF_00842695; iTF_01079911; iTF_00774504; iTF_00801865; iTF_00247210; iTF_00461578; iTF_00723082; iTF_00780266; iTF_01148106; iTF_00777389; iTF_00954477; iTF_01146253; iTF_01149613; iTF_01034606; iTF_00778767; iTF_01091951; iTF_01138959; iTF_01181903; iTF_00420560; iTF_00781040; iTF_01508080; iTF_00159857; iTF_01078225; iTF_00796531; iTF_01506356; iTF_00114965; iTF_01017749; iTF_01018581; iTF_01151221; iTF_00781846; iTF_00213463; iTF_00953527; iTF_00960183; iTF_00824761; iTF_00958681; iTF_01033753; iTF_01141689; iTF_01148826; iTF_01080732; iTF_00419773; iTF_00779517; iTF_01145277; iTF_00959422; iTF_01021246; iTF_00776032; iTF_00843552; iTF_00007105; iTF_00178177; iTF_00408481; iTF_01245953; iTF_00156258; iTF_00659461; iTF_00148487; iTF_00342216; iTF_00660333; iTF_00680558; iTF_00155314; iTF_01134805; iTF_00022809; iTF_00410298; iTF_00021339; iTF_01135771; iTF_00656160; iTF_00288066; iTF_00673523; iTF_01359770; iTF_00827966; iTF_00430690; iTF_00197379; iTF_01206563; iTF_01202479; iTF_01204912; iTF_01205715; iTF_01204053; iTF_00411478; iTF_00942839; iTF_01203255; iTF_00771099; iTF_00761698; iTF_01386722; iTF_01388486; iTF_01387616; iTF_00681667; iTF_01193603; iTF_00689412; iTF_00674309; iTF_01090791; iTF_00994368; iTF_00150566; iTF_01562022; iTF_00710224; iTF_00711035; iTF_00323527; iTF_00462407; iTF_00657221; iTF_01081609; iTF_01437065; iTF_01251754; iTF_01415858; iTF_00025259; iTF_00412524; iTF_01153039; iTF_01501136; iTF_00844369; iTF_00077499; iTF_00205137; iTF_00409298; iTF_00923698; iTF_00960946; iTF_01333842; iTF_00752092; iTF_01569362; iTF_01156468; iTF_00354101; iTF_01302357; iTF_00275286; iTF_01367926; iTF_00325399; iTF_00806744; iTF_01403449; iTF_00027770; iTF_00026869; iTF_00876186; iTF_01155207; iTF_00871308; iTF_00874477; iTF_00357523; iTF_00358579; iTF_00875322; iTF_00896826; iTF_01503898; iTF_00207933; iTF_00208898; iTF_00642333; iTF_00289630; iTF_01158974; iTF_01153994; iTF_01157804; iTF_01564670; iTF_00654303; iTF_00149414; iTF_00715807; iTF_00035680; iTF_01072512; iTF_01336864;
90% Identity
iTF_00430690;
80% Identity
-