Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.28 6.2e+02 0.7 8.7 9 16 11 18 11 19 0.96

2 3 7.3e-09 1.6e-05 25.0 2.7 4 21 52 69 49 70 0.89

3 3 7.8 1.7e+04 -3.9 6.9 10 15 83 88 82 89 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.28	6.2e+02	0.7	8.7	9	16	11	18	11	19	0.96
2	3	7.3e-09	1.6e-05	25.0	2.7	4	21	52	69	49	70	0.89
3	3	7.8	1.7e+04	-3.9	6.9	10	15	83	88	82	89	0.83

Coding Sequence: ATGTCTGATGATGGATCAACAGCTGTAGAGAAGCGAGGGCGTGGTAGACCTAAACCAAATGGAACACAATCAGAGGCTAAAGCAGAAACTAAAAAACGAGGAAAACCACCTGCAGCTGCCAAGGTAAAAGAGTCTGCAAAGTCATCTGATGAGGAAGCGCCAGTAGCGAAAAGGGGGCGCGGCAGACCTAAGGGCTCTAAGAAAAAAGTGGCATCTCCAAAAGCAAAGAGTGGATCAGGGGAAGGAAGAGGAAGGGGACGGCCGCGCAAACGCGCGGATGCTGCTCCACCTAAAAAAGATGCCGCTTCAACAGAAGAAGAACAGGATGATGAAGAAGATGAGGAAGGTTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKRGRGRPKPNGTQSEAKAETKKRGKPPAAAKVKESAKSSDEEAPVAKRGRGRPKGSKKKVASPKAKSGSGEGRGRGRPRKRADAAPPKKDAASTEEEQDDEEDEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2