Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0024 71 3.9 1.8 11 16 13 18 11 20 0.83

2 5 0.097 2.9e+03 -1.3 2.1 12 15 33 36 32 37 0.93

3 5 0.16 4.7e+03 -1.9 0.9 16 22 45 51 42 51 0.77

4 5 3.4e-10 1e-05 25.8 2.6 4 21 55 72 53 73 0.91

5 5 0.65 1.9e+04 -3.9 6.9 10 15 86 91 85 92 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0024	71	3.9	1.8	11	16	13	18	11	20	0.83
2	5	0.097	2.9e+03	-1.3	2.1	12	15	33	36	32	37	0.93
3	5	0.16	4.7e+03	-1.9	0.9	16	22	45	51	42	51	0.77
4	5	3.4e-10	1e-05	25.8	2.6	4	21	55	72	53	73	0.91
5	5	0.65	1.9e+04	-3.9	6.9	10	15	86	91	85	92	0.83

Coding Sequence: ATGTCGGACGATGGATCAACGGCAGTGGAGAAGAAAGGACGCGGTAGACCTAAAGCAAATGGAACACAATCAGAAGCCAAAGGGGATGCTAAGAAAAGAGGAAGACCTCCAGTGGCAGCTGTACCTAAAACGAAGGAGTCTAAAAATTCTTCAGATGAAGAACAAGCACCTGCAGCAAAAAGAGGAAGAGGCAGACCTAAAGGGTCCAAGAAAAAGGTGGCAGCTCCTAAAGCAAAGAGTGCTCAAGGAGAAGGTCGGGGTCGTGGTCGGCCTCGTAAAGATGCCCCTCCAGCTAAAAAAGATGAAGCTTATACTGAAGAAGAACCTGAAGATGAGGAAGAAGAAGATAGCTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKANGTQSEAKGDAKKRGRPPVAAVPKTKESKNSSDEEQAPAAKRGRGRPKGSKKKVAAPKAKSAQGEGRGRGRPRKDAPPAKKDEAYTEEEPEDEEEEDSSDQ

Sequence clustering based on sequence similarity using MMseqs2