Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.013 2.3e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 4 0.038 6.9e+02 1.0 0.3 12 15 33 36 32 43 0.84

3 4 1.6e-09 2.8e-05 24.6 2.3 6 21 55 70 51 71 0.85

4 4 2 3.6e+04 -4.7 1.7 10 12 87 89 87 89 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.013	2.3e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	4	0.038	6.9e+02	1.0	0.3	12	15	33	36	32	43	0.84
3	4	1.6e-09	2.8e-05	24.6	2.3	6	21	55	70	51	71	0.85
4	4	2	3.6e+04	-4.7	1.7	10	12	87	89	87	89	0.84

Coding Sequence: ATGTCTGATGATGGATCAACGGCTGTGGAGAAAAAAGGAAGGGGTAGACCTAAAGCCAATGGCACACAAGCGgAAGCGAAAGTAGATGCAAAGAAACGAGGTAGACCACCAGCAGCTTCTAAGGCCAAGGAATCCACAAAATCATCTGATGATGAGCAGGCACCAGTAGTGAAAAGAGGAAGAGGCCGGCCCAAAGGCTCGAAGAAAAAGGCTGCAGTCCCCAAGGCTAAGGCTGCTGGCAAGGGTCGTGCAGGTTCGCGACCGCGTAAAGACGCGCCGCCGAAGAAGGACGCCGCGTCCACAGAAGAGGAACaagacgacgatgatgatgaggaggGCTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKANGTQAEAKVDAKKRGRPPAASKAKESTKSSDDEQAPVVKRGRGRPKGSKKKAAVPKAKAAGKGRAGSRPRKDAPPKKDAASTEEEQDDDDDEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2