Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0026 80 3.8 2.0 11 16 13 18 11 20 0.83

2 6 0.15 4.6e+03 -1.8 3.9 12 15 33 36 32 49 0.61

3 6 4.1e-10 1.3e-05 25.5 2.2 4 21 53 70 51 71 0.87

4 6 0.58 1.8e+04 -3.7 0.4 6 9 72 75 72 75 0.83

5 6 0.64 2e+04 -3.9 6.9 10 15 84 89 83 90 0.83

6 6 0.17 5.2e+03 -2.0 1.5 4 9 92 97 91 98 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0026	80	3.8	2.0	11	16	13	18	11	20	0.83
2	6	0.15	4.6e+03	-1.8	3.9	12	15	33	36	32	49	0.61
3	6	4.1e-10	1.3e-05	25.5	2.2	4	21	53	70	51	71	0.87
4	6	0.58	1.8e+04	-3.7	0.4	6	9	72	75	72	75	0.83
5	6	0.64	2e+04	-3.9	6.9	10	15	84	89	83	90	0.83
6	6	0.17	5.2e+03	-2.0	1.5	4	9	92	97	91	98	0.83

Coding Sequence: ATGTCTGATGATGGATCTACAGCCGTTGAGAAAAAGGGCCGCGGAAGGCCGAAGTCTAATGGCACCCAATCGGAGGCGAAGGGTGATACCAAGAAACGAGGCAGACCACCAGTGGCAACTAAAACTAAAGAATCAAAAAATTCATCTGATGATGAACAAGCACCCGTAGCAAAGAGAGGAAGGGGCCGACCCAAAGGTTCCAAGAAGAAGGCACCAGCGCCAAAAGCCAAGAGTGCCTCTGGAGAAGGTCGGGGACGCGGTAGGCCGCGCAAAGATGTACCTCCGCCCAAAAAGGATGCTGCCTCCACTGAAGAGGAACAAGACgaagatgaagaagaagagGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKSNGTQSEAKGDTKKRGRPPVATKTKESKNSSDDEQAPVAKRGRGRPKGSKKKAPAPKAKSASGEGRGRGRPRKDVPPPKKDAASTEEEQDEDEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2