Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0024 56 3.9 1.8 11 16 13 18 11 20 0.83

2 6 0.6 1.4e+04 -3.8 0.3 12 14 33 35 33 37 0.88

3 6 0.011 2.7e+02 1.7 0.9 15 22 43 50 41 50 0.88

4 6 8.1e-10 1.9e-05 24.6 2.3 6 21 56 71 52 72 0.85

5 6 0.65 1.5e+04 -3.9 6.9 10 15 85 90 84 91 0.83

6 6 1 2.4e+04 -5.2 1.7 6 9 95 98 94 99 0.74

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0024	56	3.9	1.8	11	16	13	18	11	20	0.83
2	6	0.6	1.4e+04	-3.8	0.3	12	14	33	35	33	37	0.88
3	6	0.011	2.7e+02	1.7	0.9	15	22	43	50	41	50	0.88
4	6	8.1e-10	1.9e-05	24.6	2.3	6	21	56	71	52	72	0.85
5	6	0.65	1.5e+04	-3.9	6.9	10	15	85	90	84	91	0.83
6	6	1	2.4e+04	-5.2	1.7	6	9	95	98	94	99	0.74

Coding Sequence: ATGTCGGACGATGGTTCAACAGCAGTCGAAAAGAAAGGTCGTGGTAGACCTAAAGCTAATGGGACACAATCAGAAGCTAAAGGTGATGCTAAGAAAAGAGGCAGACAACCAGCGGCAGCAGTGAAACCTAAAGAATCTAAAAATTCCTCAGATGATGAACAAGCACCAGTGGTCAAAAGAGGAAGGGGCAGACCTAAAGGATCTAAGAAAAAGGCAGCAGCCCCTAAAGCTAAGAGTGGTTCTGGTGAAGGAAGAGGTCGAGGTCGGCCACGTAAGGATGCACCTCCTCCTAAAAAAGATGCAGGCTCAACTGAAGAGGAACAAGAAGATGAAGAAGAAGAGGAGGGGTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKANGTQSEAKGDAKKRGRQPAAAVKPKESKNSSDDEQAPVVKRGRGRPKGSKKKAAAPKAKSGSGEGRGRGRPRKDAPPPKKDAGSTEEEQEDEEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2