Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0066 1.5e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 5 0.16 3.6e+03 -1.9 3.7 12 15 33 36 32 50 0.69

3 5 1.7e-09 3.8e-05 23.6 0.9 4 20 54 70 52 71 0.88

4 5 0.13 2.9e+03 -1.6 4.6 10 15 85 90 84 91 0.84

5 5 0.61 1.4e+04 -3.8 1.7 4 9 93 98 92 99 0.77

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0066	1.5e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	5	0.16	3.6e+03	-1.9	3.7	12	15	33	36	32	50	0.69
3	5	1.7e-09	3.8e-05	23.6	0.9	4	20	54	70	52	71	0.88
4	5	0.13	2.9e+03	-1.6	4.6	10	15	85	90	84	91	0.84
5	5	0.61	1.4e+04	-3.8	1.7	4	9	93	98	92	99	0.77

Coding Sequence: ATGTCTGACGATGGGTCAACAGTCGTTGAAAAGAAAGGGCGCGGCAGACCAAAAGCCAATGGAACTCAAGCTGAATCCAAAGGTGATACTAAAAAGCGAGGCAGACCAGCGGCACCAGCAGCCAAGACGAAGGAATCAAAAAATTCATCTGATGATGAGCAGGCACCTGCAGTAAAGAGGGGCAGAGGGAGGCCTAAAGGATCTAAAAAGATTGCTCCTGCTTCAAAGGCAAAGGGTGGATCTGGCGAAGGACGAGCTAGGGGCAGGCCACGTAAAGAAGCCCCTCCACCCAAAAAAGATGCAGTTTCTACTGAGGAGGAACAAGACGAAGATGAAGAAGATGAGGGTTCTGACCAATAA
Protein Sequence: MSDDGSTVVEKKGRGRPKANGTQAESKGDTKKRGRPAAPAAKTKESKNSSDDEQAPAVKRGRGRPKGSKKIAPASKAKGGSGEGRARGRPRKEAPPPKKDAVSTEEEQDEDEEDEGSDQ

Sequence clustering based on sequence similarity using MMseqs2