Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0067 1.5e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 5 0.019 4.3e+02 1.0 0.3 12 15 33 36 32 43 0.84

3 5 4.1e-09 9.2e-05 22.3 5.0 4 21 53 70 51 71 0.88

4 5 0.63 1.4e+04 -3.9 6.9 10 15 83 88 82 89 0.83

5 5 0.6 1.3e+04 -3.8 1.7 4 9 91 96 90 97 0.77

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0067	1.5e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	5	0.019	4.3e+02	1.0	0.3	12	15	33	36	32	43	0.84
3	5	4.1e-09	9.2e-05	22.3	5.0	4	21	53	70	51	71	0.88
4	5	0.63	1.4e+04	-3.9	6.9	10	15	83	88	82	89	0.83
5	5	0.6	1.3e+04	-3.8	1.7	4	9	91	96	90	97	0.77

Coding Sequence: ATGTCTGATGATGGATCTACCGTTGTTGAGAAGAAAGGACGTGGTAGACCAAAATCCAATGGAACACAGGCGGAAGCGAAAGCAGATACGAAGAAAAGAGGTCGACCACCGGCAGCTTCTAAAGCTAAGGAATCCACAAAGTCGTCGGACGATGAACAGGCGCCGGTAGCGAAAAGAGGAAGGGGCAGACCTAAGGGCTCCAAGAAAAAGCCACCTCAGAAGGCCAAgAGTGGGTCGGGTGAGGGTCGGGGCCGTGGCCGACCGCGTAAGGAAGCCCCACCACCGAAGAAggacgcagcctcctctgaggAGGACCAAGACGAGGATGAGGACGATGAAGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTVVEKKGRGRPKSNGTQAEAKADTKKRGRPPAASKAKESTKSSDDEQAPVAKRGRGRPKGSKKKPPQKAKSGSGEGRGRGRPRKEAPPPKKDAASSEEDQDEDEDDEGSDQ

Sequence clustering based on sequence similarity using MMseqs2