Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0069 3.1e+02 2.4 3.2 11 16 13 18 11 19 0.82

2 5 1 4.5e+04 -4.6 6.8 12 15 34 37 31 51 0.71

3 5 1.5e-10 6.9e-06 26.9 1.9 4 21 55 72 53 73 0.90

4 5 0.65 2.9e+04 -3.9 6.9 10 15 86 91 85 92 0.83

5 5 0.17 7.6e+03 -2.0 1.5 4 9 94 99 93 100 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0069	3.1e+02	2.4	3.2	11	16	13	18	11	19	0.82
2	5	1	4.5e+04	-4.6	6.8	12	15	34	37	31	51	0.71
3	5	1.5e-10	6.9e-06	26.9	1.9	4	21	55	72	53	73	0.90
4	5	0.65	2.9e+04	-3.9	6.9	10	15	86	91	85	92	0.83
5	5	0.17	7.6e+03	-2.0	1.5	4	9	94	99	93	100	0.83

Coding Sequence: ATGTCTGACGATGGATCCACAGCCGTTGAAAAGAAGGGTCGCGGCAGACCTAAATCTAATGGAACACCAGCAGTGGAAGCAAAAGTTGAACCAAAAAAGAGAGGGAGACCTGCAGTTCCCGCCAAGCCCGTAAAAGAGTCGAAAAATTCATCTGATGATGAACAGGCACCAGCAGCCAAACGAGGCAGAGGCAGGCCGAAGGGATCTAAGAAAAAGGCTGCAGCACCAAAAGCTAAAAGTGGATCTGGTGAAGGTAGAGGAAGAGGTAGACCACGTAAAGATGTCCCACCTCCCAAAAAGGATGCCGCATCCACTGAAGAAGAACAAGATGATGATGAGGAGGAAGAAGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKSNGTPAVEAKVEPKKRGRPAVPAKPVKESKNSSDDEQAPAAKRGRGRPKGSKKKAAAPKAKSGSGEGRGRGRPRKDVPPPKKDAASTEEEQDDDEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2