Basic Information

Gene Symbol
-
Assembly
GCA_948473455.1
Location
OX419588.1:13668942-13669487[-]

Transcription Factor Domain

TF Family
HMGA
Domain
HMGA domain
PFAM
AnimalTFDB
TF Group
Unclassified Structure
Description
This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 4 0.0062 1.6e+02 2.6 3.2 11 16 13 18 11 19 0.82
2 4 0.019 4.9e+02 1.0 0.3 12 15 33 36 32 43 0.84
3 4 2.1e-09 5.7e-05 23.2 0.7 6 20 55 69 51 71 0.84
4 4 0.1 2.7e+03 -1.3 0.8 8 12 83 87 82 87 0.85

Sequence Information

Coding Sequence
ATGTCTGATGATGGATCAACGGTTGTGGAGAAGAAGGGGCGAGGTAGACCTAAAGCCAATGGCACACAGGCGGAAGCGAAAGGAGACGCAAAGAAGCGGGGTAGACCACCAGCAGCTTCTAAGGCCAAGGAATCAGCTAAGTCATCTGATGATGAGCAGGCGCCAGTAGTGAAAAGAGGAAGAGGAAGACCCAAAGGCTCTAAAAAGGCAGCTCCCAAGGCTAAGCCCGCTAGTAAGGGTCGCGGGCCGTCGCGACCGCGCAAAGACGCGCCACCGAAGAAGGACGCCGGATCCACAGAGGAGGAACAAGACGACGAGGATGATGAAGAGGGCTCTGACCAGTAA
Protein Sequence
MSDDGSTVVEKKGRGRPKANGTQAEAKGDAKKRGRPPAASKAKESAKSSDDEQAPVVKRGRGRPKGSKKAAPKAKPASKGRGPSRPRKDAPPKKDAGSTEEEQDDEDDEEGSDQ

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00878866;
90% Identity
-
80% Identity
-