Ssim006409.1
Basic Information
- Insect
- Spicauda simplicius
- Gene Symbol
- -
- Assembly
- GCA_949699795.1
- Location
- OX453059.1:16702809-16703368[+]
Transcription Factor Domain
- TF Family
- HMGA
- Domain
- HMGA domain
- PFAM
- AnimalTFDB
- TF Group
- Unclassified Structure
- Description
- This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.0025 79 3.8 2.0 11 16 13 18 11 20 0.83 2 6 1 3.1e+04 -4.6 7.4 12 15 33 36 26 49 0.69 3 6 3.4e-10 1.1e-05 25.8 2.1 4 21 53 70 51 71 0.88 4 6 0.67 2.1e+04 -3.9 0.5 15 17 73 75 73 75 0.81 5 6 0.63 2e+04 -3.9 6.9 10 15 83 88 82 89 0.83 6 6 1 3.1e+04 -5.3 1.3 6 9 93 96 92 96 0.72
Sequence Information
- Coding Sequence
- ATGTCTGATGATGGTTCAACAACTGTGGAGAAGAAAGGGCGCGGTAGACCTAAATCTAATGGAACACAATCAgaACCCAAAGGTGATGCTAAAAAGCGAGGCAGACCACCGGCAGGTGCTAAAACCAAAGAATCAAAGAATTCATCTGACGATGAACAGGCACCGGCAGTGAAAAGAGGCAGGGGCAGGCCCAAAGGCTCTAAGAAAAAGGCAGCACCAAAGGGAAAGGCTAGTTCTGGAGAGGGACGCGGTCGCGGCCGACCACGCAAGGACGCTCCTCCACCCAAGAAGGACGCAGCATCTACTGAAGAGGAACAGGACGAAGATGAAGAAGAAGAGGGCTCTGACCAGTAA
- Protein Sequence
- MSDDGSTTVEKKGRGRPKSNGTQSEPKGDAKKRGRPPAGAKTKESKNSSDDEQAPAVKRGRGRPKGSKKKAAPKGKASSGEGRGRGRPRKDAPPPKKDAASTEEEQDEDEEEEGSDQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00878866;
- 90% Identity
- iTF_00288066;
- 80% Identity
- -