Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0025 86 3.8 2.0 11 16 13 18 11 20 0.83

2 4 0.29 9.9e+03 -2.8 0.3 12 14 33 35 29 35 0.57

3 4 4e-10 1.4e-05 25.5 2.2 4 21 53 70 51 71 0.87

4 4 0.1 3.4e+03 -1.3 4.5 10 15 83 88 79 89 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0025	86	3.8	2.0	11	16	13	18	11	20	0.83
2	4	0.29	9.9e+03	-2.8	0.3	12	14	33	35	29	35	0.57
3	4	4e-10	1.4e-05	25.5	2.2	4	21	53	70	51	71	0.87
4	4	0.1	3.4e+03	-1.3	4.5	10	15	83	88	79	89	0.87

Coding Sequence: ATGTCTGATGACGGTTCTACTGCTGTTGAGAAGAAAGGACGCGGTAGACCGAAATCGAATGGAACACAATCGGAGACTAAAGGCGATTCAAAAAAAAGAGGAAGACTAGCAGTACCAGCTAAAACAAAAGAATCTGCGAAATCCTCTGATGATGAACAAGCACCGGTAGCAAAGAGAGGGCGAGGCCGACCCAAAGGCTCAAAGAAAAAGGCATATAAGCCAAAGACTACACCACCTGTTGAGGGGCGAGGTCGTGGCAGACCACGCAAGGACACCGCTCCTCCTAAAAAGGATGTGGCTTCAACTGAAGAAGAACAAGAGGACGATGAGGAGGAGGAAGGGTCTGATCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKSNGTQSETKGDSKKRGRLAVPAKTKESAKSSDDEQAPVAKRGRGRPKGSKKKAYKPKTTPPVEGRGRGRPRKDTAPPKKDVASTEEEQEDDEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2