Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.13 3.3e+03 -1.6 0.8 11 16 13 18 11 19 0.72

2 4 1 2.6e+04 -5.0 1.4 12 14 33 35 33 35 0.91

3 4 3.9e-10 1e-05 25.6 2.2 4 21 53 70 51 71 0.87

4 4 0.61 1.6e+04 -3.8 6.9 10 15 80 85 79 86 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.13	3.3e+03	-1.6	0.8	11	16	13	18	11	19	0.72
2	4	1	2.6e+04	-5.0	1.4	12	14	33	35	33	35	0.91
3	4	3.9e-10	1e-05	25.6	2.2	4	21	53	70	51	71	0.87
4	4	0.61	1.6e+04	-3.8	6.9	10	15	80	85	79	86	0.83

Coding Sequence: ATGTCTGATGACGGATCAACAACCGTGGAGAAGAAGGGACGCGGCAGAGCGAAATCTAATGGAACACAATCAGAGGCTAAAGCAGACACTAAAAAGAGGGGAAGGCAGCCAGCACCTGCTAAGGCGAAAGAATCTGCAAAATCGTCGGATGATGAACAAGCGCCCGTAGCGAAAAGAGGGCGAGGCAGGCCCAAAGGATCCAAGAAAAAGGCTGCGTCTAAGGCAAAGACTGAGGGACGAGGTCGCGGCAGACCGCGTAAGGACCCCGCCCCCCCCAAGAAGGATGCTGCATCAACTGAGGAGGAGCAGGAGGATGACGAAGAAGATGAAGGCTCTGACCagtaa
Protein Sequence: MSDDGSTTVEKKGRGRAKSNGTQSEAKADTKKRGRQPAPAKAKESAKSSDDEQAPVAKRGRGRPKGSKKKAASKAKTEGRGRGRPRKDPAPPKKDAASTEEEQEDDEEDEGSDQ

Sequence clustering based on sequence similarity using MMseqs2