Cper006602.1
Basic Information
- Insect
- Cydalima perspectalis
- Gene Symbol
- -
- Assembly
- GCA_951394215.1
- Location
- OX596205.1:13100615-13101133[+]
Transcription Factor Domain
- TF Family
- HMGA
- Domain
- HMGA domain
- PFAM
- AnimalTFDB
- TF Group
- Unclassified Structure
- Description
- This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.13 3.3e+03 -1.6 0.8 11 16 13 18 11 19 0.72 2 4 1 2.6e+04 -5.0 1.4 12 14 33 35 33 35 0.91 3 4 3.9e-10 1e-05 25.6 2.2 4 21 53 70 51 71 0.87 4 4 0.61 1.6e+04 -3.8 6.9 10 15 80 85 79 86 0.83
Sequence Information
- Coding Sequence
- ATGTCTGATGACGGATCAACAACCGTGGAGAAGAAGGGACGCGGCAGAGCGAAATCTAATGGAACACAATCAGAGGCTAAAGCAGACACTAAAAAGAGGGGAAGGCAGCCAGCACCTGCTAAGGCGAAAGAATCTGCAAAATCGTCGGATGATGAACAAGCGCCCGTAGCGAAAAGAGGGCGAGGCAGGCCCAAAGGATCCAAGAAAAAGGCTGCGTCTAAGGCAAAGACTGAGGGACGAGGTCGCGGCAGACCGCGTAAGGACCCCGCCCCCCCCAAGAAGGATGCTGCATCAACTGAGGAGGAGCAGGAGGATGACGAAGAAGATGAAGGCTCTGACCagtaa
- Protein Sequence
- MSDDGSTTVEKKGRGRAKSNGTQSEAKADTKKRGRQPAPAKAKESAKSSDDEQAPVAKRGRGRPKGSKKKAASKAKTEGRGRGRPRKDPAPPKKDAASTEEEQEDDEEDEGSDQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00878866;
- 90% Identity
- -
- 80% Identity
- -