Basic Information

Gene Symbol
-
Assembly
GCA_907165235.1
Location
OU015623.1:8060916-8061443[-]

Transcription Factor Domain

TF Family
HMGA
Domain
HMGA domain
PFAM
AnimalTFDB
TF Group
Unclassified Structure
Description
This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 5 0.0026 1.2e+02 3.8 2.0 11 16 13 18 11 20 0.83
2 5 0.096 4.4e+03 -1.2 2.1 12 15 33 36 32 37 0.93
3 5 3.2e-10 1.4e-05 25.9 3.7 4 22 53 71 51 71 0.89
4 5 0.68 3.1e+04 -3.9 0.5 15 17 74 76 74 76 0.81
5 5 0.65 3e+04 -3.9 6.9 10 15 84 89 83 90 0.83

Sequence Information

Coding Sequence
ATGTCTGATGACGGTTCAACAACTGTGGAAAAGAAAGGACGTGGTAGACCAAAATCTAATGGGACACAATCAgAAGCCAAAGGAGATGCTAAAAAACGAGGTCGACCACCAGCAGCTACTAAAGCTAAAGAGTCAACAAAATCATCTGATGATGAACAGGCACCGGTAGCAAAAAGAGGCCGTGGTCGACCTAAAGGTTCAAAGAAAAAGTCTGCAGCTCCTAAAGGAAAGAGTGGGTCAGGAGAAGGCCGGGGTAGAGGACGGCCTCGCAAAGATGCAGCTCCACCTAAAAAAGATGCTGCTTCTACTGAGGAGGAGCAAGAAGATGAAGAAGAGGAAGAAGGTTCTGACCAGTAA
Protein Sequence
MSDDGSTTVEKKGRGRPKSNGTQSEAKGDAKKRGRPPAATKAKESTKSSDDEQAPVAKRGRGRPKGSKKKSAAPKGKSGSGEGRGRGRPRKDAAPPKKDAASTEEEQEDEEEEEGSDQ*

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00878866;
90% Identity
-
80% Identity
-