Basic Information

Gene Symbol
-
Assembly
GCA_018245675.1
Location
DWDX01004110.1:4319-4837[-]

Transcription Factor Domain

TF Family
HMGA
Domain
HMGA domain
PFAM
AnimalTFDB
TF Group
Unclassified Structure
Description
This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 6 0.0067 1.9e+02 2.5 3.2 11 16 13 18 11 19 0.82
2 6 0.13 3.8e+03 -1.7 3.8 12 15 33 36 32 49 0.61
3 6 3.4e-10 9.6e-06 25.8 2.1 4 21 53 70 51 71 0.88
4 6 0.67 1.9e+04 -3.9 0.5 15 17 73 75 73 75 0.81
5 6 0.63 1.8e+04 -3.9 6.9 10 15 83 88 82 89 0.83
6 6 0.16 4.6e+03 -2.0 1.5 4 9 91 96 90 97 0.83

Sequence Information

Coding Sequence
ATGTCTGACGACGGTTCAACAACTGTGGAGAAGAAGGGGCGCGGTAGACCAAAATCCAATGGAACACAATCGGAGCCCAAATTGGATACTAAAAAGCGAGGTAGACCACCGGCAGCTACTAAAACCAAAGAATCTAAGAATTCATCCGATGATGAACAAGCCCCAGCAGTGAAAAGAGGCCGAGGCAGGCCTAAAGGATCTAAGAAAAAGGCAGCACCGAAGGGAAAGTCTGGTTCTGGTGAGGGACGCGGTCGCGGACGACCTCGCAAAGACGTTCCACCTCCCAAGAAAGATGCTGCCTCCACTGAAGAAGATCAGGACGAAGATGAAGAGGAAGAAGGCTCTGACCAGTAA
Protein Sequence
MSDDGSTTVEKKGRGRPKSNGTQSEPKLDTKKRGRPPAATKTKESKNSSDDEQAPAVKRGRGRPKGSKKKAAPKGKSGSGEGRGRGRPRKDVPPPKKDAASTEEDQDEDEEEEGSDQ

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00878866;
90% Identity
iTF_00288066;
80% Identity
-