Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0027 54 3.7 2.0 11 16 13 18 11 20 0.83

2 4 0.19 3.8e+03 -2.2 3.9 12 15 33 36 31 50 0.70

3 4 4.3e-10 8.7e-06 25.5 1.9 4 21 54 71 52 72 0.89

4 4 0.71 1.4e+04 -4.0 6.9 10 15 88 93 88 94 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0027	54	3.7	2.0	11	16	13	18	11	20	0.83
2	4	0.19	3.8e+03	-2.2	3.9	12	15	33	36	31	50	0.70
3	4	4.3e-10	8.7e-06	25.5	1.9	4	21	54	71	52	72	0.89
4	4	0.71	1.4e+04	-4.0	6.9	10	15	88	93	88	94	0.81

Coding Sequence: ATGTCTGATGACGGATCAACCGCAGTTGAGAAGAAAGGACGTGGTAGACCTAAGTCTAATGGAACACAATCAGAAACTAAAGGGGATTCCAAGAAAAGAGGAAGACCACCAGCAGCTGCAGCTAAGACTAAGGAATCCAAAAATTCATCTGATGATGAACAAGCACCTGCAGTCAAAAGAGGAAGGGGCAGGCCAAAGGGTTCCAAGAAAAAAATGGCTGCTTCTAGAGCAAAGAGCAGTGGTGGTGGTGGCGGTGAGGGGCGAGGTCGTGGCAGACCGCGCAAGGACGCACCTCCGCCCAAGAAAGATGCTGCTTCTACTGAGGAGGAACAAGAAGATGAAGAAGAGGAAGAGGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKSNGTQSETKGDSKKRGRPPAAAAKTKESKNSSDDEQAPAVKRGRGRPKGSKKKMAASRAKSSGGGGGEGRGRGRPRKDAPPPKKDAASTEEEQEDEEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2