Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0068 1.8e+02 2.4 3.2 11 16 13 18 11 19 0.82

2 6 0.03 7.9e+02 0.4 0.4 12 15 33 36 32 37 0.94

3 6 0.0085 2.2e+02 2.1 0.8 15 22 43 50 39 50 0.86

4 6 5.7e-10 1.5e-05 25.1 3.7 6 22 56 72 52 72 0.87

5 6 0.65 1.7e+04 -3.9 6.9 10 15 85 90 84 91 0.83

6 6 1 2.6e+04 -5.2 1.7 6 9 95 98 94 99 0.74

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0068	1.8e+02	2.4	3.2	11	16	13	18	11	19	0.82
2	6	0.03	7.9e+02	0.4	0.4	12	15	33	36	32	37	0.94
3	6	0.0085	2.2e+02	2.1	0.8	15	22	43	50	39	50	0.86
4	6	5.7e-10	1.5e-05	25.1	3.7	6	22	56	72	52	72	0.87
5	6	0.65	1.7e+04	-3.9	6.9	10	15	85	90	84	91	0.83
6	6	1	2.6e+04	-5.2	1.7	6	9	95	98	94	99	0.74

Coding Sequence: ATGTCTGACGATGGTTCAACAGCGGTGGAGAAGAAAGGTCGCGGAAGACCTAAATCTAATGGAACACAACCGGAGGCTAAAGGTGATGCTAAAAAACGAGGCAGACCTGTGCAACCAGCGGCCAAGCCCAAAGAATCTAAAAATTCCTCCGATGATGAACAGGCACCCGTAGTTAAAAGGGGAAGAGGCAGGCCTAAAGGATCTAAGAAAAAATCAGTAGCTGCTAAAGCAAAGAGTTCTTCGGGTGAAGGACGAGGCCGTGGAAGGCCGCGCAAAGATGCGCCACCACCTAAAAAAGATGCCGGCTCCACTGAAGAGGAACAAGAGGATGAAGAAGAAGAAGAAGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKSNGTQPEAKGDAKKRGRPVQPAAKPKESKNSSDDEQAPVVKRGRGRPKGSKKKSVAAKAKSSSGEGRGRGRPRKDAPPPKKDAGSTEEEQEDEEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2