Pmac002676.1
Basic Information
- Insect
- Papilio machaon
- Gene Symbol
- -
- Assembly
- GCA_001298355.1
- Location
- NW:2911618-2913181[-]
Transcription Factor Domain
- TF Family
- HMGA
- Domain
- HMGA domain
- PFAM
- AnimalTFDB
- TF Group
- Unclassified Structure
- Description
- This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.0066 90 2.5 3.2 11 16 13 18 11 19 0.82 2 5 0.16 2.2e+03 -1.9 3.7 12 15 33 36 32 50 0.69 3 5 1.7e-09 2.3e-05 23.6 1.4 4 20 54 70 52 72 0.87 4 5 0.12 1.6e+03 -1.5 4.6 10 15 85 90 84 91 0.83 5 5 0.61 8.4e+03 -3.8 1.7 4 9 93 98 92 99 0.77
Sequence Information
- Coding Sequence
- ATGTCTGATGATGGGTCAACGGTTGTTGAAAAGAAAGGGCGCGGCAGACCAAAAGCTAATGGAACTCAAGCTGAATCCAAAGGTGATACTAAAAAGAGAGGCCGACCCGCAGCACCAGCAGCTAAGACGAAGGAATCAAAAAATTCATCTGATGATGAGCAGGCGCCTGCAGTAAAGAGAGGAAGAGGGAGACCTAAGGGATCTAAAAAGAGTGCTCCGGCTTCAAAGGCTAAAGGTGGTTCGGGAGAGGCACGAGGTAGGGGTAGGCCACGTAAAGAAGCACCTCCACCCAAAAAAGATGCAGCTTCTACTGAGGAAGAACAAGACGAAGATGAAGAAGATGAGGGATCTGACCAATAA
- Protein Sequence
- MSDDGSTVVEKKGRGRPKANGTQAESKGDTKKRGRPAAPAAKTKESKNSSDDEQAPAVKRGRGRPKGSKKSAPASKAKGGSGEARGRGRPRKEAPPPKKDAASTEEEQDEDEEDEGSDQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00878866;
- 90% Identity
- iTF_01143841;
- 80% Identity
- iTF_01148106;