Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0024 70 3.9 1.8 11 16 13 18 11 20 0.83

2 5 0.73 2.2e+04 -4.1 5.8 12 15 33 36 32 50 0.68

3 5 4.1e-10 1.2e-05 25.5 2.2 4 21 54 71 52 72 0.87

4 5 0.65 1.9e+04 -3.9 6.9 10 15 85 90 84 91 0.83

5 5 1 2.9e+04 -5.3 1.3 6 9 95 98 94 98 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0024	70	3.9	1.8	11	16	13	18	11	20	0.83
2	5	0.73	2.2e+04	-4.1	5.8	12	15	33	36	32	50	0.68
3	5	4.1e-10	1.2e-05	25.5	2.2	4	21	54	71	52	72	0.87
4	5	0.65	1.9e+04	-3.9	6.9	10	15	85	90	84	91	0.83
5	5	1	2.9e+04	-5.3	1.3	6	9	95	98	94	98	0.72

Coding Sequence: atgtctgaCGACGGTTCAACGGCAGTGGAAAAAAAAGGACGCGGCAGACCCAAAGCGAATGGAACACAATCGgAAGCCAAAGGAGATGCCAAAAAAAGAGGCAGACCCCCTGTAGCTCCAGCCAAATCAAAAGAATCCAAAAATTCATCAGATGATGAACAGGCACCAGTGGCGAAAAGGGGTAGAGGTAGACCGAAAGGTTCAAAGAAAAAGGCAGCTGCTCCAAAAGCTaagggtGGATCTGGTGAAGGCCGTGGTCGTGGTAGGCCACGCAAGGATGCACCACCACCTAAAAAGGATGCCGCCTCAACCGAAGAAGAACAAGAAgatgaagaagaagaagaaggtTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKANGTQSEAKGDAKKRGRPPVAPAKSKESKNSSDDEQAPVAKRGRGRPKGSKKKAAAPKAKGGSGEGRGRGRPRKDAPPPKKDAASTEEEQEDEEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2