Ccro012897.1
Basic Information
- Insect
- Colias croceus
- Gene Symbol
- -
- Assembly
- GCA_905220415.1
- Location
- HG991964.1:8474578-8475119[+]
Transcription Factor Domain
- TF Family
- HMGA
- Domain
- HMGA domain
- PFAM
- AnimalTFDB
- TF Group
- Unclassified Structure
- Description
- This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.0064 1.5e+02 2.5 3.2 11 16 13 18 11 19 0.82 2 5 0.16 3.8e+03 -1.9 4.1 12 15 33 36 31 49 0.63 3 5 7.9e-10 1.9e-05 24.6 2.3 6 21 55 70 51 71 0.85 4 5 0.12 2.9e+03 -1.6 4.6 10 15 83 88 82 89 0.84 5 5 1 2.4e+04 -5.3 1.3 6 9 93 96 92 96 0.72
Sequence Information
- Coding Sequence
- ATGTCTGATGATGGTTCAACCGCCGTTGAAAAGAAAGGCCGAGGTAGACCGAAAGCCAACGGAACACAAGCAGAAGCAAAAGTTGACTCGAAGAAAAGAGGTAGACCAGCGGCAGCACCCAAAGTAAAAGAGTCAAAAAATTCTTCGGATGATGAACAGGCACCAGTAGTCAAAAGGGGTAGAGGCAGGCCTAAAGGTTCAAAGAAAAAAGCGGCACCAAAAGCTAAGAGTGGTTCCGGTGAGGGAAGAGCTCGAGGCAGACCGCGCAAGGATGCACCGCCTCCTAAAAAAGATGCTGCCTCTACTGAAGAAGAACAAGAAGACGATGAAGAGGATGAAGGCTCAGACCAATAA
- Protein Sequence
- MSDDGSTAVEKKGRGRPKANGTQAEAKVDSKKRGRPAAAPKVKESKNSSDDEQAPVVKRGRGRPKGSKKKAAPKAKSGSGEGRARGRPRKDAPPPKKDAASTEEEQEDDEEDEGSDQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00878866;
- 90% Identity
- iTF_00357523; iTF_00711035; iTF_01562022; iTF_00710224; iTF_00985119; iTF_00695618; iTF_00248099; iTF_00421379; iTF_00212484; iTF_00986116; iTF_00801865; iTF_00247210; iTF_00723082; iTF_00420560; iTF_00159857; iTF_00213463; iTF_00960183; iTF_00824761; iTF_00958681; iTF_00419773; iTF_00959422; iTF_01021246; iTF_00843552; iTF_00205137; iTF_01078225; iTF_01079073; iTF_01507233; iTF_01079911; iTF_01508080; iTF_01506356; iTF_01080732; iTF_00354101; iTF_00953527;
- 80% Identity
- iTF_00357523;