Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0067 1.9e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 6 0.12 3.3e+03 -1.5 3.6 12 15 33 36 32 49 0.61

3 6 4.7e-11 1.3e-06 28.5 2.2 3 21 52 70 51 71 0.94

4 6 0.67 1.9e+04 -3.9 0.5 15 17 73 75 73 75 0.81

5 6 0.63 1.8e+04 -3.9 6.9 10 15 83 88 82 89 0.83

6 6 1 2.8e+04 -5.3 1.3 6 9 93 96 92 96 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0067	1.9e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	6	0.12	3.3e+03	-1.5	3.6	12	15	33	36	32	49	0.61
3	6	4.7e-11	1.3e-06	28.5	2.2	3	21	52	70	51	71	0.94
4	6	0.67	1.9e+04	-3.9	0.5	15	17	73	75	73	75	0.81
5	6	0.63	1.8e+04	-3.9	6.9	10	15	83	88	82	89	0.83
6	6	1	2.8e+04	-5.3	1.3	6	9	93	96	92	96	0.72

Coding Sequence: ATGTCTGATGACGGTTCAACAACTGTGGAGAAGAAGGGGCGCGGTAGACCAAAATCCAATGGAACACAATCAGAGCCCAAAGTGGACACTAAAAAGCGAGGAAGACCACCAGCAGCTGCAAAAACCAAAGAATCCAAGAATTCATCTGATGATGAACAAGTCCCGGCAGTGAAACGAGGCAGAGGCAGGCCTAAGGGATCTAAGAAAAAGGCAGCACCGAAGGGTAAGACTGGGTCTGGTGAAGGACGTGGACGTGGACGACCGCGCAAAGATGCTCCACCACCCAAAAAAGATGCAGCCTCCACCGAAGAGGAACAGGATGAAGATGAAGAGGAAGAAGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTTVEKKGRGRPKSNGTQSEPKVDTKKRGRPPAAAKTKESKNSSDDEQVPAVKRGRGRPKGSKKKAAPKGKTGSGEGRGRGRPRKDAPPPKKDAASTEEEQDEDEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2