Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0066 1.8e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 5 0.022 6.2e+02 0.8 2.3 15 22 43 50 33 50 0.85

3 5 4.1e-10 1.2e-05 25.5 2.2 4 21 54 71 52 72 0.87

4 5 0.65 1.8e+04 -3.9 6.9 10 15 85 90 84 91 0.83

5 5 1 2.8e+04 -5.2 1.7 6 9 95 98 94 99 0.74

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0066	1.8e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	5	0.022	6.2e+02	0.8	2.3	15	22	43	50	33	50	0.85
3	5	4.1e-10	1.2e-05	25.5	2.2	4	21	54	71	52	72	0.87
4	5	0.65	1.8e+04	-3.9	6.9	10	15	85	90	84	91	0.83
5	5	1	2.8e+04	-5.2	1.7	6	9	95	98	94	99	0.74

Coding Sequence: ATGTCGGACGATGGTTCAACAGCAGTCGAAAAGAAAGGACGCGGTAGACCCAAAGCTAATGGAACACAATCGGAAGCTAAAGTTGATGCTAAGAAAAGAGGCAGACAGCCAGCACCAGCAGCGAAACCTAAAGAATCCAAAAATTCCTCAGATGATGAACAAGCACCAGTGGCTAAACGAGGAAGGGGCAGACCTAAAGGATCTAAGAAGAAGGCAGCAGCCCCTAAAGCAAAGAGTGGTTCTGGGGAAGGAAGAGGTCGAGGTCGGCCACGTAAGGATGCACCTCCTCCTAAAAAAGATGCAGGCTCAACTGAAGAGGAACAAGAAGATGAAGAAGAAGAAGAGGGGTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKANGTQSEAKVDAKKRGRQPAPAAKPKESKNSSDDEQAPVAKRGRGRPKGSKKKAAAPKAKSGSGEGRGRGRPRKDAPPPKKDAGSTEEEQEDEEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2