Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0065 3.4e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 5 0.15 7.7e+03 -1.8 3.9 12 15 33 36 31 49 0.64

3 5 1e-10 5.3e-06 27.5 3.0 3 21 52 70 51 71 0.93

4 5 0.58 3e+04 -3.7 0.4 6 9 72 75 72 75 0.83

5 5 0.12 6.5e+03 -1.6 4.6 10 15 84 89 83 90 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0065	3.4e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	5	0.15	7.7e+03	-1.8	3.9	12	15	33	36	31	49	0.64
3	5	1e-10	5.3e-06	27.5	3.0	3	21	52	70	51	71	0.93
4	5	0.58	3e+04	-3.7	0.4	6	9	72	75	72	75	0.83
5	5	0.12	6.5e+03	-1.6	4.6	10	15	84	89	83	90	0.84

Coding Sequence: ATGTCTGATGATGGATCAACTGCAGTTGAAAAGAAAGGAAGAGGTCGGCCTAAAGCTAATGGAACACAAGCAgaaGCAAAAGGGGATTCAAAGAAAAGAGGCAGGCCAGCAGCTCCAGCAAAAGTAAAAGAATCAAAAAATTCTTCAGATGAAGAACAAGTACCAGTGGCTAAAAGAGGACGAGGGCGACCCAAAGGATCAAAAAAAAAGGCACCTGCACCTAAAGCAAagGCTGCATCTGGAGAAGGTAGAGCGAGAGGGCGGCCACGTAAAGATGCAGCTCCTCCTAAAAAAGATACAGCTTCATCTGAAGAGGAGCAAgatgaggaagaagaagatgaaGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKANGTQAEAKGDSKKRGRPAAPAKVKESKNSSDEEQVPVAKRGRGRPKGSKKKAPAPKAKAASGEGRARGRPRKDAAPPKKDTASSEEEQDEEEEDEGSDQ

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00878866;
90% Identity: iTF_01206563; iTF_01202479; iTF_01204912; iTF_01205715; iTF_01204053; iTF_01203255; iTF_00878866; iTF_00114965;
80% Identity: -