Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0025 87 3.8 2.0 11 16 13 18 11 20 0.83

2 4 0.094 3.3e+03 -1.2 2.1 12 15 33 36 32 37 0.93

3 4 7.9e-10 2.7e-05 24.6 2.3 6 21 55 70 51 71 0.85

4 4 0.58 2e+04 -3.7 3.6 6 14 79 87 74 87 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0025	87	3.8	2.0	11	16	13	18	11	20	0.83
2	4	0.094	3.3e+03	-1.2	2.1	12	15	33	36	32	37	0.93
3	4	7.9e-10	2.7e-05	24.6	2.3	6	21	55	70	51	71	0.85
4	4	0.58	2e+04	-3.7	3.6	6	14	79	87	74	87	0.72

Coding Sequence: ATGTCTGATGACGGATCAACAACCGTTGAGAAGAAGGGACGCGGCAGACCGAAATCCAATGGAACACAGTCAGAGGCTAAAGCAGACACTAAAAAGAGAGGAAGGCCGCCGGCACCGGCCAAGGCGAAAGAATCTGCAAAATCCTCTGATGATGAACAGGCACCAGTAGTGAAAAGAGGAAGAGGCAGGCCCAAAGGTTCTAAGAAAAAGGCTGCATCTAAGGCAAAGagtGCGCCTACAGAGGGGCGAGGTCGCGGCAGACAGCGTAAGGAACCTGCCCCTCCAAAGAAGGATGCTGCGTCGACTGAAGAGGAGCAGGAAGATGATGAGGAGGATGAGGGCTCTGACCAgtaa
Protein Sequence: MSDDGSTTVEKKGRGRPKSNGTQSEAKADTKKRGRPPAPAKAKESAKSSDDEQAPVVKRGRGRPKGSKKKAASKAKSAPTEGRGRGRQRKEPAPPKKDAASTEEEQEDDEEDEGSDQ

Sequence clustering based on sequence similarity using MMseqs2