Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0025 33 3.8 2.0 11 16 13 18 11 20 0.83

2 4 0.056 7.3e+02 -0.5 0.8 15 22 26 34 25 34 0.78

3 4 2.8e-09 3.7e-05 22.9 1.9 6 21 55 70 51 71 0.84

4 4 0.63 8.3e+03 -3.9 6.9 10 15 83 88 82 89 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0025	33	3.8	2.0	11	16	13	18	11	20	0.83
2	4	0.056	7.3e+02	-0.5	0.8	15	22	26	34	25	34	0.78
3	4	2.8e-09	3.7e-05	22.9	1.9	6	21	55	70	51	71	0.84
4	4	0.63	8.3e+03	-3.9	6.9	10	15	83	88	82	89	0.83

Coding Sequence: ATGTCTGATGATGGTTCAACAGTGGTTGAGAAGAAGGGACGCGGTAGACCAAAATCCAATGGAACACAATCTGAACCCAAAGGAGATTCCAAGAAAAGGGGTCGACCACCAGCAGCTACCAAGGCTAAGGAATCTGCAAAGTCCTCTGATGACGAACAGGCGCCGATAGCGAAAAGGGGAAGAGGCAGACCCAAAGGCTCCAAGAAAAGGGCTGCACCTAAAACCaagGGTGGATCTGGTGAAGGGCGCGGCCGTGGGCGACCGCGTAAGGAAGCTGCCCCCCCGAAAAAGGATGCTGCTTCCACTGAGGAGGAGCAGGACGAGGATGAGGAGGAGGAAGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTVVEKKGRGRPKSNGTQSEPKGDSKKRGRPPAATKAKESAKSSDDEQAPIAKRGRGRPKGSKKRAAPKTKGGSGEGRGRGRPRKEAAPPKKDAASTEEEQDEDEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2