Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0026 77 3.8 2.0 11 16 13 18 11 20 0.83

2 4 0.16 4.6e+03 -1.9 3.7 12 15 34 37 32 51 0.71

3 4 4.2e-10 1.2e-05 25.5 1.9 4 21 55 72 53 73 0.89

4 4 0.66 1.9e+04 -3.9 6.9 10 15 86 91 85 92 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0026	77	3.8	2.0	11	16	13	18	11	20	0.83
2	4	0.16	4.6e+03	-1.9	3.7	12	15	34	37	32	51	0.71
3	4	4.2e-10	1.2e-05	25.5	1.9	4	21	55	72	53	73	0.89
4	4	0.66	1.9e+04	-3.9	6.9	10	15	86	91	85	92	0.83

Coding Sequence: ATGTCTGACGATGGTTCAACAGCAGTGGAGAAGAAGGGACGTGGTAGACCCAAATCAAATGGAACACAACAATCAgAATCCAAAGGTGATTCGAAGAAAAGAGGTCGACCACCAGCAGCCGCAGCTAAAGTGAAGGAATCTAAAAACTCATCTGATGATGAGCAAGCACCAGCGGTTAAAAGAGGAAGAGGTAGACCAAAAGGTTCCAAGAAAAAAATGGCAGCAGCCAAAGCTAAGacTAGCTCTGGTGAAGGAAGAGGTCGCGGTAGACCTCGTAAGGATGCAGCTCCACCGAAAAAAGATGCAGCATCAACTGAAGAAGAACAGGAggatgaagaagaagaagaaggctCTGATCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKSNGTQQSESKGDSKKRGRPPAAAAKVKESKNSSDDEQAPAVKRGRGRPKGSKKKMAAAKAKTSSGEGRGRGRPRKDAAPPKKDAASTEEEQEDEEEEEGSDQ*

Sequence clustering based on sequence similarity using MMseqs2