Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0025 78 3.8 1.8 11 16 13 18 11 20 0.83

2 4 0.17 5.5e+03 -2.1 3.8 12 15 33 36 31 50 0.70

3 4 8.6e-10 2.7e-05 24.5 2.3 6 21 56 71 52 72 0.85

4 4 0.68 2.1e+04 -4.0 6.9 10 15 85 90 84 91 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0025	78	3.8	1.8	11	16	13	18	11	20	0.83
2	4	0.17	5.5e+03	-2.1	3.8	12	15	33	36	31	50	0.70
3	4	8.6e-10	2.7e-05	24.5	2.3	6	21	56	71	52	72	0.85
4	4	0.68	2.1e+04	-4.0	6.9	10	15	85	90	84	91	0.83

Coding Sequence: ATGTCTGATGATGGATCAACAGCAGTGGAGAAAAAAGGACGTGGTAGACCAAAAGCTAATGGGACACAATCGGAAGCTAAAGGAGACTCGAAGAAGCGAGGCCGACCCCCTGCAGCTGCAGCTAAAACTAAAGAATCTAAAAATTCCTCAGATGATGAACAGGCACCTGTAGTTAAAAGAGGAAGAGGCAGACCAAAAGGTTCCAAAAAGAAGGCAGTAGCACCCAAAGCAAAGAGCGGTTCGGGTGAGGGCCGAGGTCGCGGTAGGCCTCGTAAAGATGCACCTCCACCTAAAAAAGACGAAGCTTCTACTGAAGAGGAGCAAGAAGATGAAGAAGAGGAAGAAGGCTCTGACCAAAGTCGTGGGCACAGCTAG
Protein Sequence: MSDDGSTAVEKKGRGRPKANGTQSEAKGDSKKRGRPPAAAAKTKESKNSSDDEQAPVVKRGRGRPKGSKKKAVAPKAKSGSGEGRGRGRPRKDAPPPKKDEASTEEEQEDEEEEEGSDQSRGHS

Sequence clustering based on sequence similarity using MMseqs2