Phel006229.1
Basic Information
- Insect
- Papilio helenus
- Gene Symbol
- -
- Assembly
- GCA_026546675.1
- Location
- JAOCNA010000029.1:6894162-6894659[+]
Transcription Factor Domain
- TF Family
- HMGA
- Domain
- HMGA domain
- PFAM
- AnimalTFDB
- TF Group
- Unclassified Structure
- Description
- This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.0066 2.8e+02 2.5 3.2 11 16 13 18 11 19 0.82 2 5 0.16 6.9e+03 -1.9 3.7 12 15 33 36 32 50 0.69 3 5 1.7e-09 7.2e-05 23.6 1.4 4 20 54 70 52 72 0.87 4 5 0.65 2.8e+04 -3.9 6.9 10 15 85 90 84 91 0.83 5 5 0.61 2.7e+04 -3.8 1.7 4 9 93 98 92 99 0.77
Sequence Information
- Coding Sequence
- ATGTCTGACGATGGGTCAACAGTCGTTGAAAAGAAAGGGCGCGGCAGACCAAAAGCCAATGGAACTCAAGCTGAATCTAAAGGCGATACTAAAAAACGAGGCAGACCAGCGGCACCAGCAGCCAAGACGAAGGAATCAAAAAATTCATCTGATGATGAGCAGGCACCCGCAGTAAAGAGGGGCAGAGGGAGGCCTAAAGGGTCTAAAAAGAGTGCTCCTGCTTCAAAGGCTAAAGGTGGATCTGGCGAAGGACGAGGTAGGGGCAGGCCGCGTAAAGAAGCCCCTCCGCCCAAAAAAGATGCAGCTTCTACTGAGGAGGAACAAGACGAAGATGAAGAAGATGAGGGATCTGACCAATAA
- Protein Sequence
- MSDDGSTVVEKKGRGRPKANGTQAESKGDTKKRGRPAAPAAKTKESKNSSDDEQAPAVKRGRGRPKGSKKSAPASKAKGGSGEGRGRGRPRKEAPPPKKDAASTEEEQDEDEEDEGSDQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00878866;
- 90% Identity
- iTF_01147394; iTF_01143108; iTF_01140934; iTF_01142406; iTF_01144550; iTF_01148106; iTF_01146253; iTF_01149613; iTF_01138959; iTF_01141689; iTF_01148826; iTF_01145277;
- 80% Identity
- -