Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0065 1.8e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 5 0.41 1.2e+04 -3.3 0.7 12 14 33 35 30 35 0.52

3 5 0.25 7.1e+03 -2.6 1.3 17 22 44 49 43 49 0.75

4 5 8e-10 2.3e-05 24.6 2.3 6 21 55 70 51 71 0.85

5 5 0.64 1.8e+04 -3.9 6.9 10 15 84 89 83 90 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0065	1.8e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	5	0.41	1.2e+04	-3.3	0.7	12	14	33	35	30	35	0.52
3	5	0.25	7.1e+03	-2.6	1.3	17	22	44	49	43	49	0.75
4	5	8e-10	2.3e-05	24.6	2.3	6	21	55	70	51	71	0.85
5	5	0.64	1.8e+04	-3.9	6.9	10	15	84	89	83	90	0.83

Coding Sequence: ATGTCTGATGATGGATCAACAGCAGTAGAGAAGAAAGGACGCGGTAGACCCAAAGCTAATGGAACACAATCAGAGACTAAAACAGAATCTAAGAAAAGGGGCAGAGCTCCAGCTGCAGCTAAGACCAAGGAATCCAAAAATTCTTCAGACGATGAACAGGCGCCAGTAGTCAAAAGAGGAAGGGGCAGGCCCAAAGGTTCCAAGAAGAAAGCGGCAGCCCCCAAAGCAAAGAGTGGGTCTGGTGAAGGGCGAGGTCGCGGCAGACCTCGCAAGGACGCAGCGCCGCCCAAGAAAGATGCAGCGTCTACTGAAGAAGAACAGGACGATGAGGAAGAGGAAGAAGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKANGTQSETKTESKKRGRAPAAAKTKESKNSSDDEQAPVVKRGRGRPKGSKKKAAAPKAKSGSGEGRGRGRPRKDAAPPKKDAASTEEEQDDEEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2