Cleu038122.1
Basic Information
- Insect
- Cerastis leucographa
- Gene Symbol
- -
- Assembly
- GCA_963082945.1
- Location
- OY720385.1:15823365-15823915[+]
Transcription Factor Domain
- TF Family
- HMGA
- Domain
- HMGA domain
- PFAM
- AnimalTFDB
- TF Group
- Unclassified Structure
- Description
- This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.0063 2.7e+02 2.5 3.2 11 16 13 18 11 19 0.82 2 4 0.093 4e+03 -1.2 2.1 12 15 33 36 32 37 0.93 3 4 3.9e-10 1.7e-05 25.6 2.2 4 21 53 70 51 71 0.87 4 4 0.077 3.3e+03 -0.9 4.2 10 15 81 86 80 89 0.85
Sequence Information
- Coding Sequence
- ATGTCTGATGACGGATCGACGGTCGTAGAGAAGAAAGGACGCGGTAGACCAAAAGCTAATGGAACACAGCCGGAGGCTAAGAGCGATACCAAGAAAAGGGGAAGACCTCCTGCACCCACCCGGACGAAGGAATCCACTAAGTCATCGGATGATGAACAAGCTCCGGTAGCGAAACGAGGGCGAGGCAGGCCGAAGGGGTCTAAGAAAAAGGCCAAGGGAAagAGTGCACCTGTTGAAGGAAGGGGCCGTGGACGACCACGCAAGGACCCCCCACCTAAAAAAGATGCCGCTTCCACTGAAGAGGAACAAGATGATGATTACGAGGATGAAGGCTCTGAGGAGCAGTAA
- Protein Sequence
- MSDDGSTVVEKKGRGRPKANGTQPEAKSDTKKRGRPPAPTRTKESTKSSDDEQAPVAKRGRGRPKGSKKKAKGKSAPVEGRGRGRPRKDPPPKKDAASTEEEQDDDYEDEGSEEQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00111682;
- 90% Identity
- iTF_00049924; iTF_00124292; iTF_00122418; iTF_01534852; iTF_01533953; iTF_01085258; iTF_01533070; iTF_01084286; iTF_01062821; iTF_01532035; iTF_01063781; iTF_00449127; iTF_00711882; iTF_01064684; iTF_00445198; iTF_00172975; iTF_00364047; iTF_00120530; iTF_00302130; iTF_01527250; iTF_00928724; iTF_00147478; iTF_01061911; iTF_00771947; iTF_00111682; iTF_01029288; iTF_00300237; iTF_00850765; iTF_01230605; iTF_00851822; iTF_00951856; iTF_01028314; iTF_01119355; iTF_01031164; iTF_00952733; iTF_01118333; iTF_00888286; iTF_00111681; iTF_01030258; iTF_01491955; iTF_00072161; iTF_00000354; iTF_01487717; iTF_00018183; iTF_00785224; iTF_00809160; iTF_00810089; iTF_00001194; iTF_00017357; iTF_00783502; iTF_01538767; iTF_00274449; iTF_00185330; iTF_01377491; iTF_00186197; iTF_00273621; iTF_01285559; iTF_01221592; iTF_01260123; iTF_00327100; iTF_00784413; iTF_00383679; iTF_01192736; iTF_01026210; iTF_00036743; iTF_00038794; iTF_00375242; iTF_00758188; iTF_00037837; iTF_00726381; iTF_00973805; iTF_01117232; iTF_01027347; iTF_00685461; iTF_00450135; iTF_01425083; iTF_00237597; iTF_00425406; iTF_00171776; iTF_01340133; iTF_00041795; iTF_00040838; iTF_00123398; iTF_01094059; iTF_00831245; iTF_00745718; iTF_00121463; iTF_00907066; iTF_01094938; iTF_01526042; iTF_00071451; iTF_00177147; iTF_01441115; iTF_01338780; iTF_00906174; iTF_00042655; iTF_00924703; iTF_01093119; iTF_00622848; iTF_00907904; iTF_00039833; iTF_00043521; iTF_00374138; iTF_01342237;
- 80% Identity
- -