Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.15 4.3e+03 -1.8 0.9 11 16 13 18 11 19 0.71

2 4 4e-10 1.2e-05 25.5 2.2 4 21 53 70 51 71 0.87

3 4 0.069 2e+03 -0.8 4.0 10 15 83 88 82 90 0.84

4 4 1 3e+04 -5.4 6.7 2 9 88 95 87 96 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.15	4.3e+03	-1.8	0.9	11	16	13	18	11	19	0.71
2	4	4e-10	1.2e-05	25.5	2.2	4	21	53	70	51	71	0.87
3	4	0.069	2e+03	-0.8	4.0	10	15	83	88	82	90	0.84
4	4	1	3e+04	-5.4	6.7	2	9	88	95	87	96	0.81

Coding Sequence: ATGTCTGATGACGGATCGACAACCGTTGAGAAGAAAGGACGCGGTAGATCAAAATCCAATGGAACACAATCGgaAGCTAAGGGTGATTCTAAGAAACGAGTGAGACCGCCAGCTGCTACCAGGACTAAGGAATCCACAAAGTCATCGGATGATGAGCAAGCTCCGGTAGCCAAACGAGGTCGGGGCAGGCCCAAAGGATCTAAGAAGAAGGCAGCTGCAAAAGGAAAGAGTGCACCAGTTGAAGGACGGGGACGTGGACGGCCGCGCAAGGAACCTCCTCCTAAAAAAGATGCTGCTTCTTCTGAAGAAGAACAAGATGAAGATGATGAAGATGAAGGGTCTGAGGAGCAGTaa
Protein Sequence: MSDDGSTTVEKKGRGRSKSNGTQSEAKGDSKKRVRPPAATRTKESTKSSDDEQAPVAKRGRGRPKGSKKKAAAKGKSAPVEGRGRGRPRKEPPPKKDAASSEEEQDEDDEDEGSEEQ

Sequence clustering based on sequence similarity using MMseqs2