Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.17 3.5e+03 -1.1 2.1 12 15 24 27 23 28 0.93

2 3 2.1e-10 4.2e-06 27.4 3.5 4 22 44 62 42 62 0.92

3 3 0.18 3.7e+03 -1.2 4.5 10 15 74 79 73 81 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.17	3.5e+03	-1.1	2.1	12	15	24	27	23	28	0.93
2	3	2.1e-10	4.2e-06	27.4	3.5	4	22	44	62	42	62	0.92
3	3	0.18	3.7e+03	-1.2	4.5	10	15	74	79	73	81	0.84

Coding Sequence: ATGACACGACCACACCACACAACGCAAAAGAACTCACATTTGAAAGAGGCCAAGAGTGATACCAAGAAAAGAGGGAGACCACCAGCACCAACCAGGACTAAGGAATCTACAAAATCATCGGATGATGAACAAGCTCCAGCAGCAAAACGAGGTCGAGGCAGGCCTAAGGGATCTAAGAAAAAGTCTGCTGCTAAAGGAAAGAGTGCACCAGTTGAAGGAAGGGGCCGTGGAAGACCGCGCAAGGACCCACCGCCTAAAAAAGATGCCGCCTCCACTGAAGAGGAACAGGACGAAGATGAAGATGACGAAGGCTCTGAAGAGCAGTAA
Protein Sequence: MTRPHHTTQKNSHLKEAKSDTKKRGRPPAPTRTKESTKSSDDEQAPAAKRGRGRPKGSKKKSAAKGKSAPVEGRGRGRPRKDPPPKKDAASTEEEQDEDEDDEGSEEQ

Sequence clustering based on sequence similarity using MMseqs2