Mper008879.1
Basic Information
- Insect
- Melanchra persicariae
- Gene Symbol
- -
- Assembly
- GCA_947386135.1
- Location
- OX376650.1:15816613-15817137[+]
Transcription Factor Domain
- TF Family
- HMGA
- Domain
- HMGA domain
- PFAM
- AnimalTFDB
- TF Group
- Unclassified Structure
- Description
- This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.0023 57 3.9 1.8 11 16 13 18 11 20 0.83 2 4 0.094 2.3e+03 -1.2 2.1 12 15 33 36 32 37 0.93 3 4 4e-10 9.8e-06 25.6 2.2 4 21 53 70 51 71 0.87 4 4 0.078 1.9e+03 -0.9 4.2 10 15 82 87 81 90 0.85
Sequence Information
- Coding Sequence
- ATGTCTGATGACGGATCGACGGTTGTAGAGAAGAAAGGACGCGGTAGACCTAAAGCCAATGGAACACAATCAGAGGCTAAGAGTGATACCAAGAAAAGGGGGAGACCTCCTGCAGCCACCAGGACTAAGGAATCTACAAAATCATCGGACGATGAACAAGCTCCAGTAGCGAAACGAGGGCGAGGCAGGCCTAAGGGATCTAAGAAAAAGGCTGCCGCCAAAAAGAGTGCACCAGTTGAAGGAAGGGGCCGCGGACGACCACGCAAGGACCCACCACCTAAAAAAGATGCTGCCTCTACTGAAGAGGAACAAGATGAAGATGAAGACGATGAAGGCTCTGAGGAGCAGTAA
- Protein Sequence
- MSDDGSTVVEKKGRGRPKANGTQSEAKSDTKKRGRPPAATRTKESTKSSDDEQAPVAKRGRGRPKGSKKKAAAKKSAPVEGRGRGRPRKDPPPKKDAASTEEEQDEDEDDEGSEEQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00111682;
- 90% Identity
- iTF_00301195;
- 80% Identity
- -