Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0023 1e+02 3.9 1.8 11 16 13 18 11 20 0.83

2 5 0.094 4.2e+03 -1.2 2.1 12 15 33 36 32 37 0.93

3 5 1.2e-10 5.3e-06 27.2 3.5 4 22 53 71 51 71 0.91

4 5 0.42 1.9e+04 -3.3 6.5 10 15 83 88 82 90 0.84

5 5 1 4.5e+04 -5.1 1.2 6 9 92 95 91 95 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0023	1e+02	3.9	1.8	11	16	13	18	11	20	0.83
2	5	0.094	4.2e+03	-1.2	2.1	12	15	33	36	32	37	0.93
3	5	1.2e-10	5.3e-06	27.2	3.5	4	22	53	71	51	71	0.91
4	5	0.42	1.9e+04	-3.3	6.5	10	15	83	88	82	90	0.84
5	5	1	4.5e+04	-5.1	1.2	6	9	92	95	91	95	0.72

Coding Sequence: ATGTCTGATGACGGATCGACGGTCGTAGAGAAGAAAGGACGCGGTAGACCAAAAGCCAATGGAACACAATCGGAGGCTAAGAGTGATACCAAGAAAAGAGGGAGACCACCCGCACCAACCAGGACTAAGGAATCTACAAAATCATCGGATGATGAACAAGCTCCTGCAGCAAAACGAGGTCGAGGCAGGCCTAAGGGATCTAAGAAAAAGTCTGCTGCTAAAGGAAAGAGTGCACCAGTTGAAGGAAGGGGCCGTGGCAGACCGCGTAAGGACCCACCACCTAAAAAAGATGCTGCCTCCACTGAAGAGGAACAGGACGAAGATGAAGATGACGAAGGCTCTGAAGAGCAGTAA
Protein Sequence: MSDDGSTVVEKKGRGRPKANGTQSEAKSDTKKRGRPPAPTRTKESTKSSDDEQAPAAKRGRGRPKGSKKKSAAKGKSAPVEGRGRGRPRKDPPPKKDAASTEEEQDEDEDDEGSEEQ

Sequence clustering based on sequence similarity using MMseqs2