Basic Information

Gene Symbol
-
Assembly
GCA_947507525.1
Location
OX382228.1:15637790-15638348[+]

Transcription Factor Domain

TF Family
HMGA
Domain
HMGA domain
PFAM
AnimalTFDB
TF Group
Unclassified Structure
Description
This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 5 0.0023 55 3.9 1.8 11 16 13 18 11 20 0.83
2 5 0.094 2.2e+03 -1.2 2.1 12 15 33 36 32 37 0.93
3 5 4e-10 9.6e-06 25.5 2.2 4 21 53 70 51 71 0.87
4 5 0.42 1e+04 -3.3 6.5 10 15 83 88 82 90 0.84
5 5 1 2.4e+04 -5.1 1.2 6 9 92 95 91 95 0.72

Sequence Information

Coding Sequence
ATGTCTGATGACGGATCCACGGTCGTAGAGAAGAAAGGACGCGGTAGACCGAAAGCCAATGGAACACAATCAGAGGCTAAGAGTGATACCAAGAAAAGGGGGAGACCACCGGCAGCTACCAGGACTAAGGAATCTACAAAATCATCGGATGATGAACAAGCTCCAGTAGCAAAACGAGGGCGAGGCAGGCCTAAGGGATCTAAGAAAAAGGCAGCTGCTAAAGGAAAGAGTGCACCAGTTGAAGGAAGGGGCCGTGGACGACCACGCAAGGACCCACCACCTAAGAAAGATGCCGCCTCCACTGAGGAGGAACAGGATGAAGATTACGAGGATGAAGGCTCCGAGGAGCAGTAA
Protein Sequence
MSDDGSTVVEKKGRGRPKANGTQSEAKSDTKKRGRPPAATRTKESTKSSDDEQAPVAKRGRGRPKGSKKKAAAKGKSAPVEGRGRGRPRKDPPPKKDAASTEEEQDEDYEDEGSEEQ

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2