Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0023 1.3e+02 3.9 1.8 11 16 13 18 11 20 0.83

2 5 0.094 5.2e+03 -1.2 2.1 12 15 33 36 32 37 0.93

3 5 1.5e-10 8.2e-06 26.9 1.9 4 21 53 70 51 71 0.90

4 5 0.42 2.3e+04 -3.3 6.5 10 15 82 87 81 89 0.84

5 5 1 5.6e+04 -5.1 1.2 6 9 91 94 90 94 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0023	1.3e+02	3.9	1.8	11	16	13	18	11	20	0.83
2	5	0.094	5.2e+03	-1.2	2.1	12	15	33	36	32	37	0.93
3	5	1.5e-10	8.2e-06	26.9	1.9	4	21	53	70	51	71	0.90
4	5	0.42	2.3e+04	-3.3	6.5	10	15	82	87	81	89	0.84
5	5	1	5.6e+04	-5.1	1.2	6	9	91	94	90	94	0.72

Coding Sequence: ATGTCTGATGACGGAGCCACAGTCGTAGAGAAGAAAGGACGCGGTAGACCGAAAGCCAATGGAACACAATcagAGGCTAAGAGTGATACCAAGAAAAGGGGAAGACCACCGGCACCCACCAGGGGTAAGGAATCCACAAAATCATCGGATGATGAACAAGCTCCAGCAGCAAAACGAGGGCGAGGCAGGCCTAAGGGATCTAAGAAAAAGGCTGCTAAAGGAAAGAGTGCACCAGTTGAAGGAAGGGGCCGTGGACGACCGCGCAAGGACCCACCGCCTAAGAAAGATGCCGCCTCCACCGAAGAGGAACAGGATGATGATTATGAGGATGAAGGCTCTGAGGAGCAGTAA
Protein Sequence: MSDDGATVVEKKGRGRPKANGTQSEAKSDTKKRGRPPAPTRGKESTKSSDDEQAPAAKRGRGRPKGSKKKAAKGKSAPVEGRGRGRPRKDPPPKKDAASTEEEQDDDYEDEGSEEQ

Sequence clustering based on sequence similarity using MMseqs2