Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0064 1.6e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 5 0.06 1.5e+03 -0.6 1.5 12 15 33 36 31 37 0.93

3 5 4e-10 1e-05 25.5 2.2 4 21 53 70 51 71 0.87

4 5 0.63 1.6e+04 -3.9 6.9 10 15 82 87 81 88 0.83

5 5 0.6 1.5e+04 -3.8 0.9 6 9 92 95 90 96 0.74

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0064	1.6e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	5	0.06	1.5e+03	-0.6	1.5	12	15	33	36	31	37	0.93
3	5	4e-10	1e-05	25.5	2.2	4	21	53	70	51	71	0.87
4	5	0.63	1.6e+04	-3.9	6.9	10	15	82	87	81	88	0.83
5	5	0.6	1.5e+04	-3.8	0.9	6	9	92	95	90	96	0.74

Coding Sequence: ATGTCTGATGACGGTTCAACGGCTGTTGAGAAGAAAGGACGCGGCAGACCGAAAGCCAATGGAACACAATCAGAGGCCAAAGTCGATTCCAAGAAAAGAGGAAGACCCCCAGCACCTACTCGGACTAAAGAGTCTGCAAAATCTTCTGATGATGAGCAGGCGCCAGTAGCGAAAAGAGGTCGAGGCAGGCCTAAGGGCTCTAAGAAAAAGGCGGCAAAAGGAAAGAGTGCACCAGTTGAAGGAAGAGGACGTGGTAGACCGCGCAAAGACAACCCGCCACCCAAAAAAGATGCTGCTTCTACTGAAGAGGAACAAGACGAAGATGATGAGGATGAAGGATCCGAAGAGCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKANGTQSEAKVDSKKRGRPPAPTRTKESAKSSDDEQAPVAKRGRGRPKGSKKKAAKGKSAPVEGRGRGRPRKDNPPPKKDAASTEEEQDEDDEDEGSEEQ

Sequence clustering based on sequence similarity using MMseqs2