Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0065 1.1e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 5 1 1.8e+04 -5.0 1.4 12 14 34 36 34 36 0.91

3 5 0.58 1e+04 -3.7 0.3 6 8 38 40 37 40 0.83

4 5 1.2e-09 2.2e-05 24.0 3.7 4 21 51 69 48 70 0.82

5 5 0.61 1.1e+04 -3.8 6.9 10 15 80 85 79 86 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0065	1.1e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	5	1	1.8e+04	-5.0	1.4	12	14	34	36	34	36	0.91
3	5	0.58	1e+04	-3.7	0.3	6	8	38	40	37	40	0.83
4	5	1.2e-09	2.2e-05	24.0	3.7	4	21	51	69	48	70	0.82
5	5	0.61	1.1e+04	-3.8	6.9	10	15	80	85	79	86	0.83

Coding Sequence: atgtcTGATGATGGGGGTGCTGTTGTAGAGAAAAAGGGCAGAGGAAGGCCAAAATCTAATGGAACACAAGCCACtGAGGCTAAAGGTGAAGCCAAAAAGAGAGGACGCCAACCAACCCCCGCCAAAAAAGAATCCACCAAGTCATCGGACGACGAGCCCTCTGCAGCAAAACGAGGACGAGGCCGTCCCAAAGGATCTAAGAAGAAGGCTGCTAAACCCAAGGCGTCCGTTGACGGACGAGGTCGTGGACGACCACGCAAAGACGCAGCCCCACCAAAACAGCAAGCTGCGTCGACCGAAGAAGAGCAGGACGATGATGAAGAGGAAGACGCATCTGACCAGTAG
Protein Sequence: MSDDGGAVVEKKGRGRPKSNGTQATEAKGEAKKRGRQPTPAKKESTKSSDDEPSAAKRGRGRPKGSKKKAAKPKASVDGRGRGRPRKDAAPPKQQAASTEEEQDDDEEEDASDQ

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00800192; iTF_00158051; iTF_00751203; iTF_00799274; iTF_00800974; iTF_00675139; iTF_00897807; iTF_01012302; iTF_01366978; iTF_00179354; iTF_01024951; iTF_01086301;
90% Identity: iTF_01366978; iTF_00158051;
80% Identity: -