Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.014 6.5e+02 1.4 4.3 11 16 13 18 11 20 0.84

2 5 1 4.5e+04 -5.1 1.4 12 14 34 36 34 36 0.91

3 5 1 4.5e+04 -4.5 0.3 7 9 40 42 40 42 0.76

4 5 1.8e-09 8.2e-05 23.5 6.0 4 22 51 70 48 70 0.84

5 5 0.41 1.9e+04 -3.3 6.7 10 15 81 86 73 87 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.014	6.5e+02	1.4	4.3	11	16	13	18	11	20	0.84
2	5	1	4.5e+04	-5.1	1.4	12	14	34	36	34	36	0.91
3	5	1	4.5e+04	-4.5	0.3	7	9	40	42	40	42	0.76
4	5	1.8e-09	8.2e-05	23.5	6.0	4	22	51	70	48	70	0.84
5	5	0.41	1.9e+04	-3.3	6.7	10	15	81	86	73	87	0.84

Coding Sequence: ATGTCTGATGATGGTGGAGCAGTCGTCGAAAAGAAAGGCCGAGGGCGCCCGAAACCCAACGGAACACCAGTAGCTgAGGCCAAGGGTGAAGCGAAAAAAAGGGGTAGACAACCATCTACTCCTAAAAAGGAGTCTACCAAGTCTTCCGATGACGAGCCTTCAGCAGCAAAGCGAGGACGAGGTCGCCCCAAGGGCTCCAAGAAAAAGGGGGCCAAGCCCAAGAAGCCCTCCGTGGACGGGCGAGGTCGAGGCCGGCCACGCAAGGACGCGCCGCCTCCCAAGCAGCAGGCCGCCTCCACCGAGGAAGAACAAGACGATGATGAGGAAGAAGATGGCTCAGACCAATAG
Protein Sequence: MSDDGGAVVEKKGRGRPKPNGTPVAEAKGEAKKRGRQPSTPKKESTKSSDDEPSAAKRGRGRPKGSKKKGAKPKKPSVDGRGRGRPRKDAPPPKQQAASTEEEQDDDEEEDGSDQ

Sequence clustering based on sequence similarity using MMseqs2