Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.07 1.7e+03 -0.8 6.2 11 16 33 38 31 39 0.82

2 3 1.6e-09 3.8e-05 23.6 3.7 4 21 71 89 68 90 0.82

3 3 0.51 1.2e+04 -3.6 6.7 10 15 101 106 93 107 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.07	1.7e+03	-0.8	6.2	11	16	33	38	31	39	0.82
2	3	1.6e-09	3.8e-05	23.6	3.7	4	21	71	89	68	90	0.82
3	3	0.51	1.2e+04	-3.6	6.7	10	15	101	106	93	107	0.84

Coding Sequence: ATGGAGCGGCCTGAAAAACCAAATATCGATGATTGCTGTCATTCAGATAATAGTCAAAACATGTCTGATGATGGAGGAGCAATTGTAGAGAAAAAGGGTAGAGGTCGTCCAAAACCTAATGGGACACAAGCAGCAGAGACTAAAGGTGAAGCAAAAAAACGAGGCAGGCAACCGGCACCTGCTAAAAAAGAATCAACAAAATCTTCAGATGATGAGCCTTCTGCGGCAAAGCGAGGTCGAGGTCGCCCCAAGGGATCTAAGAAAAAAGCAGCCAAACCCAAGAAGCCCTCTGTTGACGGTCGAGGTCGCGGTCGGCCGCGCAAAGACGCCCCTCCTCCTAAACAAGCAGCTTCAACAGAAGAAGAACAGGACGATGACGAAGAAGAAGACGGCTCTGATCAATAG
Protein Sequence: MERPEKPNIDDCCHSDNSQNMSDDGGAIVEKKGRGRPKPNGTQAAETKGEAKKRGRQPAPAKKESTKSSDDEPSAAKRGRGRPKGSKKKAAKPKKPSVDGRGRGRPRKDAPPPKQAASTEEEQDDDEEEDGSDQ

Sequence clustering based on sequence similarity using MMseqs2