Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.75 4.6e+04 -4.1 1.7 11 14 13 16 11 16 0.68

2 4 1 6.1e+04 -5.1 1.4 12 14 37 39 37 39 0.91

3 4 1.3e-09 7.8e-05 23.9 3.7 4 21 55 73 52 74 0.82

4 4 0.41 2.5e+04 -3.3 6.6 10 15 85 90 77 91 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.75	4.6e+04	-4.1	1.7	11	14	13	16	11	16	0.68
2	4	1	6.1e+04	-5.1	1.4	12	14	37	39	37	39	0.91
3	4	1.3e-09	7.8e-05	23.9	3.7	4	21	55	73	52	74	0.82
4	4	0.41	2.5e+04	-3.3	6.6	10	15	85	90	77	91	0.83

Coding Sequence: ATGTCTGATGATGGTGGTGCGGTAGTTGAGAAGAAGGGGCGTGGACGTGTAGCCAAATCTAATGGAACTCAGGATGCTGCTAAGGAAGCTAAAGGTGAAGCGAAAAAGCGAGGTAGACAACCTTCAGCCAATCCTAAGAAAGAATCAGCAAAGTCCTCAGATGATGAACCATCAGCAGCGAAACGAGGCCGCGGCCGCCCCAAAGGATCCAAGAAGAAGGCCAGTAAGCCAAAGAAGCCCAGCGTAGAAGGAAGGGGCCGTGGCAGACCTAGGAAGGATGCACCTCCACCCAAGCAACAGGCTTCTACAGAAGAGGAGCAAGATGATGACGACGATGATGCCTCCGACCAGTAG
Protein Sequence: MSDDGGAVVEKKGRGRVAKSNGTQDAAKEAKGEAKKRGRQPSANPKKESAKSSDDEPSAAKRGRGRPKGSKKKASKPKKPSVEGRGRGRPRKDAPPPKQQASTEEEQDDDDDDASDQ

Sequence clustering based on sequence similarity using MMseqs2