Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0066 97 2.5 3.2 11 16 13 18 11 19 0.82

2 4 1 1.5e+04 -5.1 1.4 12 14 36 38 36 38 0.91

3 4 1.3e-09 1.9e-05 24.0 3.7 4 21 53 71 50 72 0.82

4 4 0.63 9.2e+03 -3.8 6.9 10 15 82 87 81 88 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0066	97	2.5	3.2	11	16	13	18	11	19	0.82
2	4	1	1.5e+04	-5.1	1.4	12	14	36	38	36	38	0.91
3	4	1.3e-09	1.9e-05	24.0	3.7	4	21	53	71	50	72	0.82
4	4	0.63	9.2e+03	-3.8	6.9	10	15	82	87	81	88	0.83

Coding Sequence: ATGTCCGACGACGGAGGCGCCGCAGTCGAGAAGAAGGGACGCGGTCGTCCCAAATCCAACGGGACGCAGGTAGCGGCCAAGGAATCCAAGGGAGAGGCCAAGAAGCGGGGACGCCAGCCCGCCCCGGCCAAGAAGGAGTCGACCAAGTCCTCCGACGACGAGCCCTCCGCGGCGAAGCGGGGGAGAGGACGTCCCAAAGGATCGAAGAAAAAAGCCGCCAAACCCAAGGCCGCCGCCGACGGCCGAGGCAGGGGGAGGCCGCGCAAGGACGCCGCCCCGCCGAAGCAGCAGGCCGCCTCCACCGAGGAGGAGCAGGACGACGACGAGGAGGAGGACGCCTCCGACCAGTAG
Protein Sequence: MSDDGGAAVEKKGRGRPKSNGTQVAAKESKGEAKKRGRQPAPAKKESTKSSDDEPSAAKRGRGRPKGSKKKAAKPKAAADGRGRGRPRKDAAPPKQQAASTEEEQDDDEEEDASDQ

Sequence clustering based on sequence similarity using MMseqs2