Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.0066 2.5e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 3 1.3e-09 4.7e-05 24.0 3.7 4 21 53 71 50 72 0.82

3 3 0.03 1.1e+03 0.4 5.9 10 16 83 89 82 90 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.0066	2.5e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	3	1.3e-09	4.7e-05	24.0	3.7	4	21	53	71	50	72	0.82
3	3	0.03	1.1e+03	0.4	5.9	10	16	83	89	82	90	0.90

Coding Sequence: ATGTCTGATGATGGTGGAGCGGTAGTGGAGAAGAAGGGGCGAGGGCGTCCCAAGTCCAATGGAACACAAGCGGCTAAGGAAGTCAAAGGAGAAGTTAAAAAGAGGGGAAGACAGCCGTCAGCCACACCTAAAAAAGAATCCGCAAAATCTTCAGATGACGAGCCCTCGGCAGCAAAGCGAGGACGTGGCCGCCCCAAGGGCTCCAAGAAGAAGGCCAGTAAGCCCAAGAAGGCCGGCGTAGAAGGCCGCGGGCGTGGTAGGCCGAAGAAGGATGCCTCTCCCCCCAAGCAGCAGCCAGCCTCCACCGAAGAGGAACCGGaagatgacgatgatgacgCCTCGGACCAGTAG
Protein Sequence: MSDDGGAVVEKKGRGRPKSNGTQAAKEVKGEVKKRGRQPSATPKKESAKSSDDEPSAAKRGRGRPKGSKKKASKPKKAGVEGRGRGRPKKDASPPKQQPASTEEEPEDDDDDASDQ

Sequence clustering based on sequence similarity using MMseqs2