Basic Information

Gene Symbol
-
Assembly
GCA_000441895.2
Location
KE524947.1:96207-97743[+]

Transcription Factor Domain

TF Family
HMGA
Domain
HMGA domain
PFAM
AnimalTFDB
TF Group
Unclassified Structure
Description
This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 4 0.00093 14 5.2 1.2 4 15 5 16 3 17 0.83
2 4 0.44 6.9e+03 -3.4 0.4 15 19 35 39 34 39 0.60
3 4 1.1e-10 1.7e-06 27.3 7.5 4 21 56 73 54 74 0.93
4 4 0.16 2.5e+03 -2.0 2.8 12 18 88 94 81 96 0.68

Sequence Information

Coding Sequence
ATGTCCGACACGGAGGTCGTTGAACCGAAGAAGGGCCGTGGACGCCCGCCAAACGCGGAAAAGAACAGCGTTGCACCGAAAAAACGTGCTCGCGCCCTTTCCCCGAAGGAGTCGAAGCTGGAGGAACGCGGTGAGAAGGATAAGGTGGTCGCATCGGACGATGGCGAGGAACCATCGCCAAAGCGGGGACGCGGACGTCCGAAGGGAAGCACGAAGAAGGTGGCGAAGCCGACCAAGAAAGCTCCCTCAGCACCGGTTGGCCGAGGCCGGGGGCGCGGCAAGAAAAAGCCAATGAAAGAGGAATCCTCCGAAGAGGAGGACGACGACGACGACGAGGACGAGGAGGACGACGAGCCGGAGGATAGCGAGGGAAACGAGGAAAACTATGGAAACGATGAGTCCGATTCGTAA
Protein Sequence
MSDTEVVEPKKGRGRPPNAEKNSVAPKKRARALSPKESKLEERGEKDKVVASDDGEEPSPKRGRGRPKGSTKKVAKPTKKAPSAPVGRGRGRGKKKPMKEESSEEEDDDDDEDEEDDEPEDSEGNEENYGNDESDS