Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0016 11 4.5 1.1 8 15 9 16 4 17 0.89

2 4 0.45 3.1e+03 -3.4 0.4 15 19 35 39 34 39 0.60

3 4 6.8e-11 4.7e-07 28.0 6.0 4 21 55 72 53 73 0.91

4 4 1 6.8e+03 -5.7 6.4 12 18 88 94 87 96 0.54

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0016	11	4.5	1.1	8	15	9	16	4	17	0.89
2	4	0.45	3.1e+03	-3.4	0.4	15	19	35	39	34	39	0.60
3	4	6.8e-11	4.7e-07	28.0	6.0	4	21	55	72	53	73	0.91
4	4	1	6.8e+03	-5.7	6.4	12	18	88	94	87	96	0.54

Coding Sequence: ATGTCCGACGCGGAGGTCGTCGAACCGAAAAAGGGCCGTGGACGTCCACCAAACGTGGAAAAGAACAGCGTCGCGCCAAAGAAACGAGCGCGGGCCCTCTCGCCGAAGGAGTCGAAGCTGGACGAGCGCGAGAAGGATAAGGTGGTCGCCTCGGACGACGGTGAGGAACCGTCGCCGAAGCGGGGCCGCGGACGCCCGAAGGGAAGCATCAAAAAGGTGGCGAAACAGCAGGCCAAGAAGGCTCCCGCGGCACCGGTGGGCAGGGGCCGGGGGCGCGGCAAGAAGAAACCGATGAAAGAGGAATCCTCCGAGGAGGAGGACGATGATGACGACGATGAGGAGGACGAGGAGGACGACGAGCCGGAGGATAGCGAGGGAAATGAGGAAAACTACGAAAACGATGGATCCGATTCGTAA
Protein Sequence: MSDAEVVEPKKGRGRPPNVEKNSVAPKKRARALSPKESKLDEREKDKVVASDDGEEPSPKRGRGRPKGSIKKVAKQQAKKAPAAPVGRGRGRGKKKPMKEESSEEEDDDDDDEEDEEDDEPEDSEGNEENYENDGSDS

Sequence clustering based on sequence similarity using MMseqs2