Agam003092.1
Basic Information
- Insect
- Anopheles gambiae
- Gene Symbol
- -
- Assembly
- GCF_000005575.2
- Location
- NT:51943625-51944991[-]
Transcription Factor Domain
- TF Family
- HMGA
- Domain
- HMGA domain
- PFAM
- AnimalTFDB
- TF Group
- Unclassified Structure
- Description
- This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.0015 19 4.5 1.1 8 15 9 16 4 17 0.89 2 4 0.036 4.5e+02 0.1 0.1 6 9 33 36 30 37 0.88 3 4 1.1e-10 1.4e-06 27.3 9.6 4 22 56 74 54 74 0.95 4 4 1 1.2e+04 -5.1 5.9 12 18 88 94 87 99 0.60
Sequence Information
- Coding Sequence
- ATGTCTGATGCCGAGGTCGTTGAACCGAAGAAGGGTCGTGGACGCCCACCGAACCCTGACAAGAACAGTGTGGCGCCGAAAAAGAGGGCCCGTGCCCCTTCGCCGAAGGAGTCAAAGCTGGCCGAGGAGCGCGAAAAGGAGAAAACCGTCGCGTCCGACGATGGCGAAGAACCGTCCCCGAAGCGGGGCCGTGGCAGACCGAAAGGAAGCACCAAGAAGTCGGCAAAAGCGGCCAAGAAAGCTCCGGCAGCACCGGTCGGCCGAGGCCGGGGCCGGGGTCGAAAGAAGCCGGTCAAAGAGGAATCCTCCGAAGAGgaggatgacgacgacgatgacgaggaTGACGAGCCGGAGGATAGCGAGGGCAATGaggaaaattatgaaaacgaAGAGTCCGATTCGTAA
- Protein Sequence
- MSDAEVVEPKKGRGRPPNPDKNSVAPKKRARAPSPKESKLAEEREKEKTVASDDGEEPSPKRGRGRPKGSTKKSAKAAKKAPAAPVGRGRGRGRKKPVKEESSEEEDDDDDDEDDEPEDSEGNEENYENEESDS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00107683;
- 90% Identity
- iTF_00108387;
- 80% Identity
- iTF_00106981;