Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.00092 17 5.2 1.2 4 15 5 16 3 17 0.83

2 4 0.44 8.3e+03 -3.4 0.4 15 19 35 39 34 39 0.60

3 4 6.6e-11 1.2e-06 28.1 6.0 4 21 55 72 53 73 0.91

4 4 1 1.9e+04 -6.2 7.0 12 18 87 93 86 96 0.58

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.00092	17	5.2	1.2	4	15	5	16	3	17	0.83
2	4	0.44	8.3e+03	-3.4	0.4	15	19	35	39	34	39	0.60
3	4	6.6e-11	1.2e-06	28.1	6.0	4	21	55	72	53	73	0.91
4	4	1	1.9e+04	-6.2	7.0	12	18	87	93	86	96	0.58

Coding Sequence: atGTCCGATACGGAGGTCGTTGAACCGAAGAAGGGTCGCGGACGTCCGCCGAATGTGGAAAAGAACAGTGTCACGCCGAAGAAACGTGCTCGCGCCCTCTCTCCAAAAGAGTCCAAATTGGAGGAGCGGGAACGTGAGAAAGTGGTCGCATCGGACGATGGCGAGGAGCCTTCGCCGAAGCGTGGGCGGGGTCGTCCAAAGGGAAGCATCAAAAAGGTGGCAAAAGCGACCAAGAAGGCTCCCGCGGCACCGGTTGGAAGAGGCCGGGGTCGcggcaaaaagaaaccgaCGAAGGAGGAGTCCTCTGAAGATGAGGATgttgacgacgatgacgaaggaGAGGAAGACGAGCCTGAGGACAGCGAGGGTAATGAGGAGAACTATGAAAATGACGAGTCCGATTCGTAA
Protein Sequence: MSDTEVVEPKKGRGRPPNVEKNSVTPKKRARALSPKESKLEEREREKVVASDDGEEPSPKRGRGRPKGSIKKVAKATKKAPAAPVGRGRGRGKKKPTKEESSEDEDVDDDDEGEEDEPEDSEGNEENYENDESDS

Sequence clustering based on sequence similarity using MMseqs2