Nmel004066.1
Basic Information
- Insect
- Nomia melanderi
- Gene Symbol
- Sub1_1
- Assembly
- GCA_003710045.1
- Location
- NW:2032703-2033831[-]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.8e-27 5.3e-23 79.3 0.1 1 51 53 104 53 105 0.97
Sequence Information
- Coding Sequence
- ATGCCAAAGTCGAAAGAATACGTGTCGACTGATGACGACAGCAGTGAAGAGGAAGTAACGTCAAAGAAGAAGCAAAAGAAAAGGGAGGCAGAGGACAAAGAGGAAAAAGTATCAAAAAAGCCAAAAAAGGAAACGCAAGAAGACGAAGGCACAACTTGGGATCTTGGAAATAATCGTCAGATTAGCGTACGAGACTTTAAAGGCAAATTGTACGTTGATATCCGAGAAATGTACTACGACAAAGATGCAAACTTAAAGCCTGGAAAGAAAGGTATCTGTTTGAATATGGCACAGTGGCGGAAATTACTATCTGTAATGGAAGATGTTGATAAAGCAGTGAAATCTAAATGCTGA
- Protein Sequence
- MPKSKEYVSTDDDSSEEEVTSKKKQKKREAEDKEEKVSKKPKKETQEDEGTTWDLGNNRQISVRDFKGKLYVDIREMYYDKDANLKPGKKGICLNMAQWRKLLSVMEDVDKAVKSKC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00087170; iTF_00118019; iTF_01424392; iTF_00085386; iTF_00086290; iTF_00088008; iTF_00088833; iTF_00084564; iTF_00141834; iTF_00142473; iTF_00141235; iTF_00140597; iTF_00684177; iTF_01169179; iTF_00676031; iTF_01123070; iTF_01122443; iTF_00183295; iTF_00183957; iTF_00966039;
- 90% Identity
- -
- 80% Identity
- -