Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0012 3.7 7.6 0.5 19 48 80 109 66 113 0.78

2 4 1.8e-05 0.056 13.4 0.0 21 52 110 141 108 143 0.89

3 4 0.004 13 5.9 0.0 21 51 138 168 136 169 0.87

4 4 0.00016 0.5 10.3 0.1 21 47 166 192 164 197 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0012	3.7	7.6	0.5	19	48	80	109	66	113	0.78
2	4	1.8e-05	0.056	13.4	0.0	21	52	110	141	108	143	0.89
3	4	0.004	13	5.9	0.0	21	51	138	168	136	169	0.87
4	4	0.00016	0.5	10.3	0.1	21	47	166	192	164	197	0.89

Coding Sequence: ATGACTAATTGTGAAATTGTTATCGTTGCTACCGATGACCAAGCAACAGATATACAAATCCCATTCAACGTGATAACCTCAGCGGCAACAGTTTCAGCGACTGGTGCCACCACTACGACACATCACCTCGCACCATTGCAACAGCATACCGAACAGCAGCAATTGCTGCAGGCAGATACACTACAGCAACAGGTGCAAGCGGGAACACTACCGCCGCACCTAGATCGTCCGCCCACAGCTGGTCCTGAAAAACCATTCCAATGTAACATATGCGAACGGCGATTTCGGCAATTAAGCACCCTCACGAATCACGTTAAAATTCACACCGGAGAGAAGCCCTACAAATGCACGATCTGTGACAAAACCTTTCGACAATCGAGCACCCTTACGAATCACATGAAAATCCACACTGGCGAGAAGCCCTTCATCTGCTCATTCTGTCCGAAGCAGTTCCGTCAGCTAAGCACACTCACGAATCACCTGAAAATCCATACCGGAGAGAAACCATTCGAATGTGCCGTCTGCAAGAAACAATTCCGCCAATCGAGTACGCTCAACAATCACATAAAGATCCATGTCATGGACAAGGTCTACATACCCGTGAAGATAAAAACGGAAGAGGACGAAGGATGA
Protein Sequence: MTNCEIVIVATDDQATDIQIPFNVITSAATVSATGATTTTHHLAPLQQHTEQQQLLQADTLQQQVQAGTLPPHLDRPPTAGPEKPFQCNICERRFRQLSTLTNHVKIHTGEKPYKCTICDKTFRQSSTLTNHMKIHTGEKPFICSFCPKQFRQLSTLTNHLKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVYIPVKIKTEEDEG*

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01223723;
90% Identity: iTF_00672405; iTF_01542594; iTF_00312098; iTF_00313922; iTF_00311459; iTF_00312933; iTF_00315593; iTF_00311308; iTF_00314638; iTF_00316271; iTF_00725040; iTF_00313105; iTF_00312243; iTF_00725173; iTF_00314806; iTF_00316438; iTF_00315448; iTF_01542461; iTF_00313759; iTF_01254470; iTF_01254308; iTF_01223723; iTF_01223875; iTF_01541817; iTF_01541675; iTF_00241214; iTF_00241067; iTF_00241707; iTF_00390023; iTF_00310666; iTF_00241841; iTF_00389882; iTF_00310526; iTF_00671151; iTF_00671270; iTF_01116669; iTF_01116817;
80% Identity: iTF_00672405;