Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0011 4.9 7.6 0.5 10 48 75 112 68 116 0.78

2 4 2.4e-05 0.1 13.0 0.0 21 52 113 144 110 146 0.89

3 4 0.0059 25 5.3 0.1 21 51 141 171 138 172 0.87

4 4 0.00016 0.69 10.3 0.1 21 47 169 195 167 200 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0011	4.9	7.6	0.5	10	48	75	112	68	116	0.78
2	4	2.4e-05	0.1	13.0	0.0	21	52	113	144	110	146	0.89
3	4	0.0059	25	5.3	0.1	21	51	141	171	138	172	0.87
4	4	0.00016	0.69	10.3	0.1	21	47	169	195	167	200	0.89

Coding Sequence: ATGACTAATTGTGAAATTGTTATCGTTGCCACAACCGATGAACCAGCAACAGATATCCAAATACCCTTTAACGTGATAGCCTCAGCGACAACAGTCGCAGCTACTGGTGCCACTACCGCAACCCATCACCTCGCTTCATTGCAGCAACAGCATAACGAACCGCAGGTGATACAACTGCAGCCAGAAACTCTCCAAGCGCAGGTGCAAGCAGGTACTTTACCGCCGCACTTGGATCGCCCGCCTACCAACGGTCCCGAAAAGCCATTCCAATGCAACATCTGTGAGCGGCGGTTTCGACAGCTGAGCACCCTAACAAATCACGTAAAGATCCACACCGGCGAGAAACCCTACAAATGTACGATCTGCGAAAAATCCTTCCGACAATCGAGCACCCTTACGAATCACATGAAAATTCATACTGGCGAGAAGCCCTTCATTTGCTCGTACTGTCCCAAGCAATTCCGCCAGCTGAGCACGCTCACCAATCACCTGAAGATCCACACCGGCGAGAAGCCATTCGAATGTGCCGTCTGCAAGAAACAATTCCGCCAATCGAGCACGCTCAACAATCACATAAAGATCCATGTCATGGACAAGGTATACATACCGGTGAAAATCAAGACCGAAGAGGAAGAGGGATGA
Protein Sequence: MTNCEIVIVATTDEPATDIQIPFNVIASATTVAATGATTATHHLASLQQQHNEPQVIQLQPETLQAQVQAGTLPPHLDRPPTNGPEKPFQCNICERRFRQLSTLTNHVKIHTGEKPYKCTICEKSFRQSSTLTNHMKIHTGEKPFICSYCPKQFRQLSTLTNHLKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVYIPVKIKTEEEEG

Sequence clustering based on sequence similarity using MMseqs2